moleculekit.molecule module#

class moleculekit.molecule.Molecule(filename=None, name=None, **kwargs)#

Bases: object

Class to manipulate molecular structures.

Molecule contains all the fields of a PDB and it is independent of any force field. It can contain multiple conformations and trajectories, however all operations are done on the current frame. The following PDB fields are accessible as attributes (record, serial, name, altloc, resname, chain, resid, insertion, coords, occupancy, beta, segid, element, charge). The coordinates are accessible via the coords attribute ([number of atoms x 3 x number of frames] where [x,y,z] are the second dimension.

Parameters:

filename (str or list of str) – Optionally load a PDB file from the specified file. If there’s no file and the value is four characters long assume it is a PDB accession code and try to download from the RCSB web server.
name (str) – Give a name to the Molecule that will be used for visualization
kwargs – Accepts any further arguments that should be passed to the Molecule.read method.

Examples

>>> mol = Molecule( './test/data/dhfr/dhfr.pdb' )  
>>> mol = Molecule( '3PTB', name='Trypsin' )
>>> print(mol)                                     
Molecule with 1701 atoms and 1 frames
Atom field - altloc shape: (1701,)
Atom field - atomtype shape: (1701,)
...

Methods

Attributes

numAtoms#

Number of atoms in the Molecule

Type:: int

numFrames#

Number of conformers / simulation frames in the Molecule

Type:: int

numResidues#

Number of residues in the Molecule

Type:: int

record#

The record field of a PDB file if the topology was read from a PDB.

Type:: np.ndarray

serial#

The serial number of each atom.

Type:: np.ndarray

name#

The name of each atom.

Type:: np.ndarray

altloc#

The alternative location flag of the atoms if read from a PDB.

Type:: np.ndarray

resname#

The residue name of each atom.

Type:: np.ndarray

chain#

The chain name of each atom.

Type:: np.ndarray

resid#

The residue ID of each atom.

Type:: np.ndarray

insertion#

The insertion flag of the atoms if read from a PDB.

Type:: np.ndarray

occupancy#

The occupancy value of each atom if read from a PDB.

Type:: np.ndarray

beta#

The beta factor value of each atom if read from a PDB.

Type:: np.ndarray

segid#

The segment ID of each atom.

Type:: np.ndarray

element#

The element of each atom.

Type:: np.ndarray

charge#

The charge of each atom.

Type:: np.ndarray

masses#

The mass of each atom.

Type:: np.ndarray

atomtype#

The atom type of each atom.

Type:: np.ndarray

formalcharge#

The formal charge of each atom

Type:: np.ndarray

coords#

A float32 array with shape (natoms, 3, nframes) containing the coordinates of the Molecule.

Type:: np.ndarray

box#

A float32 array with shape (3, nframes) containing the periodic box dimensions of an MD trajectory.

Type:: np.ndarray

boxangles#

The angles of the box. If none are set they are assumed to be 90 degrees.

Type:: np.ndarray

bonds#

Atom pairs corresponding to bond terms.

Type:: np.ndarray

bondtype#

The type of each bond in Molecule.bonds if available.

Type:: np.ndarray

angles#

Atom triplets corresponding to angle terms.

Type:: np.ndarray

dihedrals#

Atom quadruplets corresponding to dihedral terms.

Type:: np.ndarray

impropers#

Atom quadruplets corresponding to improper dihedral terms.

Type:: np.ndarray

crystalinfo#

A dictionary containing crystallographic information. It has fields [‘sGroup’, ‘numcopies’, ‘rotations’, ‘translations’]

Type:: dict

frame#

The current frame. atomselection and get commands will be calculated on this frame.

Type:: int

fileloc#

The location of the files used to read this Molecule

Type:: list

time#

The time for each frame of the simulation

Type:: list

fstep#

The step for each frame of the simulation

Type:: list

reps#

A list of representations that is used when visualizing the molecule

Type:: Representations object

viewname#

The name used for the molecule in the viewer

Type:: str

addBond(idx1, idx2, btype)#

Add a new bond to a pair of atoms

If the bond already exists it will only update it’s type

Parameters:

idx1 (int) – The index of the one atom
idx2 (int) – The index of the other atom
btype (str) – The type of the bond as a string

Examples

>>> mol.addBond(13, 18, "2") # Adds a double bond

align(sel, refmol=None, refsel=None, frames=None, matchingframes=False, mode='index', _logger=True)#

Align conformations.

Align a given set of frames of this molecule to either the current active frame of this molecule (mol.frame) or the current frame of a different reference molecule. To align to any frame other than the current active one modify the refmol.frame property before calling this method.

Parameters:

sel (str) – Atom selection string for aligning. See more here
refmol (Molecule, optional) – Optionally pass a reference Molecule on which to align. If None is given, it will align on the first frame of the same Molecule
refsel (str, optional) – Atom selection for the refmol if one is given. Default: same as sel. See more here
frames (list or range) – A list of frames which to align. By default it will align all frames of the Molecule
matchingframes (bool) – If set to True it will align the selected frames of this molecule to the corresponding frames of the refmol. This requires both molecules to have the same number of frames.
mode (str) – Options are (‘index’, ‘structure’). Setting to ‘index’ will align two structures on the atoms selected in sel and refsel in increasing order of their indices. Meaning that if sel is name CA and resid 5 3 and refsel is name CA and resid 7 8, assuming that resid 3 comes before 5, it will align the CA or resid 3 to resid 7 in refmol and 5 to 8 instead of 5-7, 3-8 as one might expect from the atomselection strings. Setting mode to ‘structure’ will perform pure structural alignment regardless of atom order using the TM-Align method.

Examples

>>> mol=tryp.copy()
>>> mol.align('protein')
>>> mol.align('name CA', refmol=Molecule('3PTB'))

alignBySequence(ref, molseg=None, refseg=None, molsel='all', refsel='all', nalignfragment=1, returnAlignments=False, maxalignments=1)#

Aligns the Molecule to a reference Molecule by their longest sequence alignment

Parameters:

ref (Molecule object) – The reference Molecule to which we want to align
molsel (str) – The atom selection of this Molecule we want to align
refsel (str) – The atom selection of ref we want to align to
nalignfragments (int) – The number of fragments used for the alignment.
returnAlignments (bool) – Return all alignments as a list of Molecules
maxalignments (int) – The maximum number of alignments we want to produce

Returns:

mols – If returnAlignments is True it returns a list of Molecules each containing a different alignment. Otherwise it modifies the current Molecule with the best single alignment.

Return type:

list

append(mol, collisions=False, coldist=1.3, removesel='all', invertcollisions=False)#

Append a molecule at the end of the current molecule

Parameters:

mol (Molecule) – Target Molecule which to append to the end of the current Molecule
collisions (bool) – If set to True it will remove residues of mol which collide with atoms of this Molecule object.
coldist (float) – Collision distance in Angstrom between atoms of the two molecules. Anything closer will be considered a collision.
removesel (str) – Atomselection for atoms to be removed from the passed molecule in case of collisions.
invertcollisions (bool) – If invertcollisions is set to True it will remove residues of this Molecule which collide with atoms of the passed mol molecule.

Example

>>> mol=tryp.copy()
>>> mol.filter("not resname BEN")
array([1630, 1631, 1632, 1633, 1634, 1635, 1636, 1637, 1638], dtype=int32)
>>> lig=tryp.copy()
>>> lig.filter("resname BEN")
array([   0,    1,    2, ..., 1698, 1699, 1700], dtype=int32)
>>> mol.append(lig)

appendFrames(mol)#

Appends the frames of another Molecule object to this object.

Parameters:: mol (Molecule) – A Molecule object.

atomselect(sel, indexes=False, strict=False, fileBonds=True, guessBonds=True, _debug=False)#

Get a boolean mask or the indexes of a set of selected atoms

Parameters:

sel (str) – Atom selection string. See more here
indexes (bool) – If True returns the indexes instead of a bitmap
strict (bool) – If True it will raise an error if no atoms were selected.
fileBonds (bool) – If True will use bonds read from files.
guessBonds (bool) – If True will use guessed bonds.

Returns:

asel – Either a boolean mask of selected atoms or their indexes

Return type:

np.ndarray

Examples

>>> mol=tryp.copy()
>>> mol.atomselect('resname MOL')
array([False, False, False, ..., False, False, False], dtype=bool)

center(loc=(0, 0, 0), sel='all')#

Moves the geometric center of the Molecule to a given location

Parameters:

loc (list, optional) – The location to which to move the geometric center
sel (str) – Atom selection string of the atoms whose geometric center we want to center on the loc position. See more here

Returns:

translation – 3D coordinates of the translation applied to the Molecule

Return type:

np.ndarray

Examples

>>> mol=tryp.copy()
>>> mol.center()
>>> mol.center([10, 10, 10], 'name CA')

copy(frames=None, sel=None)#

Create a copy of the Molecule object

Returns:

newmol (Molecule) – A copy of the object
frames (list of int) – If specified, only the selected frames will be copied.
sel (str) – Atom selection for atoms to keep in the copy.

deleteBonds(sel, inter=True)#

Deletes all bonds that contain atoms in sel or between atoms in sel.

Parameters:

sel (str) – Atom selection string of atoms whose bonds will be deleted. See more here
inter (bool) – When True it will delete also bonds between atoms in sel with bonds to atoms outside of sel. When False it will only delete bonds between atoms in sel.

dropFrames(drop=None, keep=None)#

Removes trajectory frames from the Molecule

Parameters:

drop (int or list of ints) – Index of frame, or list of frame indexes which we want to drop (and keep all others). By default it will remove all frames from the Molecule.
keep (int or list of ints) – Index of frame, or list of frame indexes which we want to keep (and drop all others).

Examples

>>> mol = Molecule('1sb0')
>>> mol.dropFrames(keep=[1,2])
>>> mol.numFrames == 2
True
>>> mol.dropFrames(drop=[0])
>>> mol.numFrames == 1
True

empty(numAtoms)#

Creates an empty molecule of numAtoms atoms.

Parameters:: numAtoms (int) – Number of atoms to create in the molecule.

Example

>>> newmol = Molecule().empty(100)

filter(sel, _logger=True)#

Removes all atoms not included in the selection

Parameters:: sel (str) – Atom selection string. See more here
Returns:: removed – An array of all atoms which did not belong to sel and were removed from the Molecule object
Return type:: np.ndarray

Examples

>>> mol=tryp.copy()
>>> mol.filter('protein')

property frame#: The currently active frame of the Molecule on which methods will be applied

property fstep#: The frame-step of the trajectory

get(field, sel=None, fileBonds=True, guessBonds=True)#

Retrieve a specific PDB field based on the selection

Parameters:

field (str) – The field we want to get. To see a list of all available fields do print(Molecule._atom_and_coord_fields).
sel (str) – Atom selection string for which atoms we want to get the field from. Default all. See more here
fileBonds (bool) – If True will use bonds read from files.
guessBonds (bool) – If True will use guessed bonds. Both fileBonds and guessBonds can be combined.

Returns:

vals – Array of values of field for all atoms in the selection.

Return type:

np.ndarray

Examples

>>> mol=tryp.copy()
>>> mol.get('resname')
array(['ILE', 'ILE', 'ILE', ..., 'HOH', 'HOH', 'HOH'], dtype=object)
>>> mol.get('resname', sel='resid 158')
array(['LEU', 'LEU', 'LEU', 'LEU', 'LEU', 'LEU', 'LEU', 'LEU'], dtype=object)

getCenter(sel='all', com=False)#

Get the center of an atom selection

Parameters:

sel (str) – Atom selection string for which to calculate the center of mass
com (bool) – If True it will calculate the center of mass. If False it will calculate the geometric center.

Returns:

center – The center of mass or geometric center of the selection

Return type:

np.ndarray

getDihedral(atom_quad)#

Get the value of a dihedral angle.

Parameters:: atom_quad (list) – Four atom indexes corresponding to the atoms defining the dihedral
Returns:: angle – The angle in radians
Return type:: float

Examples

>>> mol.getDihedral([0, 5, 8, 12])

getNeighbors(idx, bonds=None)#

Returns all atoms bonded to a specific atom

Parameters:

idx (int) – The atom for which to find bonded atoms
bonds (np.ndarray) – Override the bonds stored in the Molecule object

Returns:

atoms – The atoms bonded to idx

Return type:

list of int

guessBonds(rdkit=False)#

hasBond(idx1, idx2)#

Checks if the Molecule has a bond between two atom indexes

Parameters:

idx1 (int) – The index of the one atom
idx2 (int) – The index of the other atom

Returns:

has (bool) – True if the Molecule has that bond, False if not
btype (str) – The bond type of that bond
bidx (int) – The index of that bond in the bond/bondtype array

insert(mol, index, collisions=False, coldist=1.3, removesel='all', invertcollisions=False)#

Insert the atoms of one molecule into another at a specific index.

Parameters:

mol (Molecule) – Molecule to be inserted
index (integer) – The atom index at which the passed molecule will be inserted
collisions (bool) – If set to True it will remove residues of mol which collide with atoms of this Molecule object.
coldist (float) – Collision distance in Angstrom between atoms of the two molecules. Anything closer will be considered a collision.
removesel (str) – Atomselection for atoms to be removed from the molecule in case of collisions.
invertcollisions (bool) – If invertcollisions is set to True it will remove residues of this Molecule which collide with atoms of the passed mol molecule.

Example

>>> mol=tryp.copy()
>>> mol.numAtoms
1701
>>> mol.insert(tryp, 0)
>>> mol.numAtoms
3402

moveBy(vector, sel=None)#

mutateResidue(sel, newres)#

Mutates a residue by deleting its sidechain and renaming it

Parameters:

sel (str) – Atom selection string for the residue we want to mutate. The selection needs to include all atoms of the residue. See more here
newres (str) – The name of the new residue

Examples

>>> mol=tryp.copy()
>>> mol.mutateResidue('resid 158', 'ARG')

property numAtoms#: Number of atoms in the molecule

property numBonds#: Number of bonds in the molecule

property numFrames#: Number of coordinate frames in the molecule

property numResidues#: The number of residues in the Molecule

read(filename, type=None, skip=None, frames=None, append=False, overwrite='all', keepaltloc='A', guess=None, guessNE=None, _logger=True, **kwargs)#

Read topology, coordinates and trajectory files in multiple formats.

Detects from the extension the file type and loads it into Molecule

Parameters:

filename (str) – Name of the file we want to read
type (str, optional) – File type of the file. If None, it’s automatically determined by the extension
skip (int, optional) – If the file is a trajectory, skip every skip frames
frames (list, optional) – If the file is a trajectory, read only the given frames
append (bool, optional) – If the file is a trajectory or coor file, append the coordinates to the previous coordinates. Note append is slow.
overwrite (str, list of str) – A list of the existing fields in Molecule that we wish to overwrite when reading this file. Set to None if you don’t want to overwrite any existing fields.
keepaltloc (str) – Set to any string to only keep that specific altloc. Set to ‘all’ if you want to keep all alternative atom positions.
guess (list of str) – Properties of the molecule to guess. Can be any combination of (‘bonds’, ‘angles’, ‘dihedrals’)
guessNE (list of str) – Properties of the molecule to guess if it’s Non-Existent. Can be any combination of (‘bonds’, ‘angles’, ‘dihedrals’)

remove(selection, _logger=True)#

Remove atoms from the Molecule

Parameters:: selection (str) – Atom selection string of the atoms we want to remove. See more here
Returns:: removed – The list of atoms removed
Return type:: np.array

Example

>>> mol=tryp.copy()
>>> mol.remove('name CA')               
array([   1,    9,   16,   20,   24,   36,   43,   49,   53,   58,...

removeBond(idx1, idx2)#

Remove an existing bond between a pair of atoms

Parameters:

idx1 (int) – The index of the one atom
idx2 (int) – The index of the other atom

renumberResidues(returnMapping=False, start=0, modulo=None)#

Renumbers protein residues incrementally.

It checks for changes in either of the resid, insertion, chain or segid fields and in case of a change it creates a new residue number.

Parameters:: returnMapping (bool) – If set to True, the method will also return the mapping between the old and new residues

Examples

>>> mapping = mol.renumberResidues(returnMapping=True)

reorderAtoms(order)#

Reorder atoms in Molecule

Changes the order of atoms in the Molecule to the defined order.

Parameters:: order (list) – A list containing the new order of atoms

Examples

>>> mol = Molecule()
>>> _ = mol.empty(4)
>>> mol.name[:] = ['N', 'C', 'H', 'S']
>>> neworder = [1, 3, 2, 0]
>>> mol.reorderAtoms(neworder)
>>> print(mol.name)
['C' 'S' 'H' 'N']

rotateBy(M, center=(0, 0, 0), sel='all')#

Rotate a selection of atoms by a given rotation matrix around a center

Parameters:

M (np.ndarray) – The rotation matrix
center (list) – The rotation center
sel (str) – Atom selection string for atoms to rotate. See more here

Examples

>>> from moleculekit.util import rotationMatrix
>>> mol = tryp.copy()
>>> mol.rotateBy(rotationMatrix([0, 1, 0], 1.57))

sequence(oneletter=True, noseg=False, return_idx=False, sel='all', _logger=True)#

Return the aminoacid sequence of the Molecule.

Parameters:

oneletter (bool) – Whether to return one-letter or three-letter AA codes. There should be only one atom per residue.
noseg (bool) – Ignore segments and return the whole sequence as single string.
return_idx (bool) – If True, the function also returns the indexes of the atoms of each residue in the sequence
sel (str) – Atomselection for which to return the sequence

Returns:

sequence – The primary sequence as a dictionary segid - string (if oneletter is True) or segid - list of strings (otherwise).

Return type:

str

Examples

>>> mol=tryp.copy()
>>> mol.sequence()
{'0': 'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'}
>>> sh2 = Molecule("1LKK")
>>> pYseq = sh2.sequence(oneletter=False)
>>> pYseq['1']
['PTR', 'GLU', 'GLU', 'ILE']
>>> pYseq = sh2.sequence(oneletter=True)
>>> pYseq['1']
'XEEI'

set(field, value, sel=None)#

Set the values of a Molecule field based on the selection

Parameters:

field (str) – The field we want to set. To see a list of all available fields do print(Molecule._atom_and_coord_fields).
value (string or integer) – All atoms that match the atom selection will have the field field set to this scalar value (or 3-vector if setting the coordinates)
sel (str) – Atom selection string for atom which to set. See more here

Examples

>>> mol=tryp.copy()
>>> mol.set('segid', 'P', sel='protein')

setDihedral(atom_quad, radians, bonds=None, guessBonds=False)#

Sets the angle of a dihedral.

Parameters:

atom_quad (list) – Four atom indexes corresponding to the atoms defining the dihedral
radians (float) – The angle in radians to which we want to set the dihedral
bonds (np.ndarray) – An array containing all bonds of the molecule. This is needed if multiple modifications are done as the bond guessing can get messed up if atoms come very close after the rotation.
guessBonds (bool) – Set to True if you want to guess bonds based on atom distances if they are not defined

Examples

>>> mol.setDihedral([0, 5, 8, 12], 0.16)
>>> # If we perform multiple modifications, calculate bonds first and pass them as argument to be safe
>>> bonds = mol._getBonds()
>>> mol.setDihedral([0, 5, 8, 12], 0.16, bonds=bonds)
>>> mol.setDihedral([18, 20, 24, 30], -1.8, bonds=bonds)

toDict(fields=None)#

Returns a dictionary representation of the molecule

Parameters:: fields (list of str) – The fields to include in the representation. By default it will include only topology fields.

toGraph(fields=None, distances=False)#

Converts the Molecule to a networkx graph.

Each node corresponds to an atom and edges correspond to bonds

toOpenFFMolecule()#

translateBy(vector, sel=None)#

Move a selection of atoms by a given vector

Parameters:

vector (list) – 3D coordinates to add to the Molecule coordinates
sel (str) – Atom selection string of atoms which we want to move. See more here

Examples

>>> mol=tryp.copy()
>>> mol.moveBy([3, 45 , -8])

view(sel=None, style=None, color=None, guessBonds=True, viewer=None, hold=False, name=None, viewerhandle=None, gui=False, pmviewurl='http://localhost:8090')#

Visualizes the molecule in a molecular viewer

Parameters:

sel (str) – Atom selection string for the representation. See more here
style (str) – Representation style. See more here.
color (str or int) – Coloring mode (str) or ColorID (int). See more here.
guessBonds (bool) – Allow the viewer to guess bonds for the molecule
viewer (str ('pmview', 'pymol', 'vmd', 'webgl')) – Choose viewer backend. Default is taken from either moleculekit.config or if it doesn’t exist from moleculekit.config
hold (bool) – If set to True, it will not visualize the molecule but instead collect representations until set back to False.
name (str, optional) – A name to give to the molecule in the viewer
viewerhandle (VMD object, optional) – A specific viewer in which to visualize the molecule. If None it will use the current default viewer.
pmviewurl (string) – URL of pmview REST server

wrap(wrapsel='all', fileBonds=True, guessBonds=False, wrapcenter=None)#

Wraps the coordinates of the molecule into the simulation box

It assumes that all bonded groups are sequential in Molecule. I.e. you don’t have a molecule B in between the atoms of molecule A. It also requires correct bonding (ideally read from a topology file).

Parameters:

wrapsel (str) – Atom selection string of atoms on which to center the wrapping box. See more here
fileBonds (bool) – Whether to use the bonds read from the file or to guess them
guessBonds (bool) – Whether to guess the bonds. If fileBonds is True these will get appended
wrapcenter (array_like, optional) – The center around which to wrap. If not provided, it will be calculated from the atoms in wrapsel. Normally you want to use the wrapsel option and not the wrapcenter as the coordinates of the selection can change during a simulation and wrapsel will keep that selection in the center for all frames.

Examples

>>> mol=tryp.copy()
>>> mol.wrap()
>>> mol.wrap('protein')

write(filename, sel=None, type=None, **kwargs)#

Writes the topology and coordinates of the Molecule in any of the supported formats.

Parameters:

filename (str) – The filename of the file we want to write to disk
sel (str, optional) – Atom selection string of the atoms we want to write. If None, it will write all atoms. See more here
type (str, optional) – The filetype we want to write. By default, detected from the file extension

property x#: Get the x coordinates at the current frame

property y#: Get the y coordinates at the current frame

property z#: Get the z coordinates at the current frame

class moleculekit.molecule.Representations(mol)#

Bases: object

Class that stores representations for Molecule.

Examples

>>> from moleculekit.molecule import Molecule
>>> mol = tryp.copy()
>>> mol.reps.add('protein', 'NewCartoon')
>>> print(mol.reps)                     
rep 0: sel='protein', style='NewCartoon', color='Name'
>>> mol.view() 
>>> mol.reps.remove() 

add(sel=None, style=None, color=None, frames=None, opacity=None)#

Adds a new representation for Molecule.

Parameters:

sel (str) – Atom selection string for the representation. See more here
style (str) – Representation style. See more here.
color (str or int) – Coloring mode (str) or ColorID (int). See more here.
frames (list) – List of frames to visualize with this representation. If None it will visualize the current frame only.
opacity (float) – Opacity of the representation. 0 is fully transparent and 1 is fully opaque.

append(reps)#

list()#: Lists all representations. Equivalent to using print.

remove(index=None)#

Removed one or all representations.

Parameters:: index (int) – The index of the representation to delete. If none is given it deletes all.

exception moleculekit.molecule.TopologyInconsistencyError(value)#: Bases: Exception

class moleculekit.molecule.UniqueAtomID(**kwargs)#

Bases: object

static fromMolecule(mol, sel=None, idx=None)#

selectAtom(mol, indexes=True, ignore=None)#

class moleculekit.molecule.UniqueResidueID(**kwargs)#

Bases: object

static fromMolecule(mol, sel=None, idx=None)#

selectAtoms(mol, indexes=True, ignore=None)#

moleculekit.molecule.calculateUniqueBonds(bonds, bondtype)#

Given bonds and bondtypes calculates unique bonds dropping any duplicates

Parameters:

bonds (np.ndarray) – The bonds of a molecule
bondtype (np.ndarray) – The bond type of each bond in the bonds array

Returns:

uqbonds (np.ndarray) – The unique bonds of the molecule
uqbondtype (np.ndarray) – The corresponding bond types for uqbonds

Examples

>>> from moleculekit.molecule import Molecule
>>> mol = Molecule('3PTB')
>>> mol.bonds, mol.bondtype = calculateUniqueBonds(mol.bonds, mol.bondtype)  # Overwrite the bonds and bondtypes with the unique ones

moleculekit.molecule.getBondedGroups(mol, bonds=None)#

Calculates all bonded groups in a Molecule

Parameters:

mol (Molecule) – A Molecule object
bonds (np.ndarray) – Optionally pass a different array of bonds. If None it will take the bonds from mol.bonds.

Returns:

groups (np.ndarray) – Groups is an array which contains the starting index of each group.
group (np.ndarray) – An array with the group index of each atom

Examples

>>> mol = Molecule("structure.prmtop")
>>> mol.read("output.xtc")
>>> groups, _ = getBondedGroups(mol)
>>> for i in range(len(groups)-1):
...     print(f"Group {i} starts at index {groups[i]} and ends at index {groups[i+1]-1}")

moleculekit.molecule.mol_equal(mol1, mol2, checkFields=('record', 'serial', 'name', 'altloc', 'resname', 'chain', 'resid', 'insertion', 'occupancy', 'beta', 'segid', 'element', 'charge', 'masses', 'atomtype', 'formalcharge', 'coords'), exceptFields=None, fieldPrecision=None, dtypes=False, uqBonds=False, _logger=True)#

Compare two Molecules for equality.

Parameters:

mol1 (Molecule) – The first molecule to compare
mol2 (Molecule) – The second molecule to compare to the first
checkFields (list) – A list of fields to compare. By default compares all atom information and coordinates in the molecule
exceptFields (list) – A list of fields to not compare.
fieldPrecision (dict) – A dictionary of field, precision key-value pairs which defines the numerical precision of the value comparisons of two arrays
dtypes (bool) – Set to True to also compare datatypes of the fields
uqBonds (bool) – Set to True to compare unique bonds instead of all bonds
_logger (bool) – Set to False to disable the printing of the differences in the two Molecules

Returns:

equal – Returns True if the molecules are equal or False if they are not.

Return type:

bool

Examples

>>> mol_equal(mol1, mol2, checkFields=['resname', 'resid', 'segid'])
>>> mol_equal(mol1, mol2, exceptFields=['record', 'name'])
>>> mol_equal(mol1, mol2, fieldPrecision={'coords': 1e-5})