moleculekit.molecule module#
- class moleculekit.molecule.Molecule(filename=None, name=None, **kwargs)#
Bases:
objectClass to read, write and manipulate molecular structures.
Molecule is the main class of MoleculeKit. It stores all the relevant molecular information for a system and allows many different operations to be performed on it, including adding or removing atoms, bonds, calculating various properties of the system, and visualizing the molecule. Molecule can read a large variety of molecular file formats and convert between them, therefore it can also be used as a molecular file format converter.
- Parameters:
filename (str or list of str) – Optionally load a PDB file from the specified file. If there’s no file and the value is four characters long assume it is a PDB accession code and try to download from the RCSB web server.
name (str) – Give a name to the Molecule that will be used for visualization
kwargs – Accepts any further arguments that should be passed to the Molecule.read method.
Examples
>>> mol = Molecule('./test/data/dhfr/dhfr.pdb') >>> mol = Molecule('3PTB') >>> print(mol) Molecule with 1701 atoms and 1 frames Atom field - altloc shape: (1701,) Atom field - atomtype shape: (1701,) ...
- addBond(idx1, idx2, btype)#
Add a new bond to a pair of atoms
If the bond already exists it will only update it’s type
- Parameters:
Examples
>>> mol.addBond(13, 18, "2") # Adds a double bond
- align(sel, refmol=None, refsel=None, frames=None, matchingframes=False, mode='index', _logger=True)#
Align conformations.
Align a given set of frames of this molecule to either the current active frame of this molecule (mol.frame) or the current frame of a different reference molecule. To align to any frame other than the current active one modify the refmol.frame property before calling this method.
- Parameters:
sel (str) – Atom selection string for aligning. See more here
refmol (
Molecule, optional) – Optionally pass a reference Molecule on which to align. If None is given, it will align on the first frame of the same Moleculerefsel (str, optional) – Atom selection for the refmol if one is given. Default: same as sel. See more here
frames (list or range) – A list of frames which to align. By default it will align all frames of the Molecule
matchingframes (bool) – If set to True it will align the selected frames of this molecule to the corresponding frames of the refmol. This requires both molecules to have the same number of frames.
mode (str) – Options are (‘index’, ‘structure’). Setting to ‘index’ will align two structures on the atoms selected in sel and refsel in increasing order of their indices. Meaning that if sel is name CA and resid 5 3 and refsel is name CA and resid 7 8, assuming that resid 3 comes before 5, it will align the CA or resid 3 to resid 7 in refmol and 5 to 8 instead of 5-7, 3-8 as one might expect from the atomselection strings. Setting mode to ‘structure’ will perform pure structural alignment regardless of atom order using the TM-Align method.
Examples
>>> mol=tryp.copy() >>> mol.align('protein') >>> mol.align('name CA', refmol=Molecule('3PTB'))
- alignBySequence(ref, molseg=None, refseg=None, molsel='all', refsel='all', nalignfragment=1, returnAlignments=False, maxalignments=1)#
Aligns the Molecule to a reference Molecule by their longest sequence alignment
- Parameters:
ref (
Moleculeobject) – The reference Molecule to which we want to alignmolsel (str) – The atom selection of this Molecule we want to align
refsel (str) – The atom selection of ref we want to align to
nalignfragments (int) – The number of fragments used for the alignment.
returnAlignments (bool) – Return all alignments as a list of Molecules
maxalignments (int) – The maximum number of alignments we want to produce
- Returns:
mols – If returnAlignments is True it returns a list of Molecules each containing a different alignment. Otherwise it modifies the current Molecule with the best single alignment.
- Return type:
- altloc: ndarray[Any, dtype[object_]]#
The alternative location flag of the atoms if read from a PDB.
- append(mol, collisions=False, coldist=1.3, removesel='all', invertcollisions=False)#
Append a molecule at the end of the current molecule
- Parameters:
mol (
Molecule) – Target Molecule which to append to the end of the current Moleculecollisions (bool) – If set to True it will remove residues of mol which collide with atoms of this Molecule object.
coldist (float) – Collision distance in Angstrom between atoms of the two molecules. Anything closer will be considered a collision.
removesel (str) – Atomselection for atoms to be removed from the passed molecule in case of collisions.
invertcollisions (bool) – If invertcollisions is set to True it will remove residues of this Molecule which collide with atoms of the passed mol molecule.
Example
>>> mol=tryp.copy() >>> mol.filter("not resname BEN") array([1630, 1631, 1632, 1633, 1634, 1635, 1636, 1637, 1638], dtype=int32) >>> lig=tryp.copy() >>> lig.filter("resname BEN") array([ 0, 1, 2, ..., 1698, 1699, 1700], dtype=int32) >>> mol.append(lig)
- appendFrames(mol)#
Appends the frames of another Molecule object to this object.
- Parameters:
mol (
Molecule) – A Molecule object.
- atomselect(sel, indexes=False, strict=False, fileBonds=True, guessBonds=True, _debug=False)#
Get a boolean mask or the indexes of a set of selected atoms
- Parameters:
sel (str or np.ndarray) – Either an atom selection string (see more here), a boolean mask of length
numAtoms, or an integer array of atom indices. Non-string inputs short-circuit the selection engine entirely: the array is returned (or converted to the requested form) without any parsing, which lets you reuse a precomputed selection. The same trick works for any otherMoleculemethod that takes an atom selection string (copy,filter,remove,get, etc.) — pass a precomputed boolean mask or index array in place of the string and the call skips re-parsing, which is significantly faster when the same selection is reused many times. The mask or indices must match the current state of the molecule though: any change to the number or order of atoms (e.g. afterfilter,remove,append, sorting, or adding/removing hydrogens) makes them stale and they will silently refer to the wrong atoms.indexes (bool) – If True returns the indexes instead of a bitmap
strict (bool) – If True it will raise an error if no atoms were selected.
fileBonds (bool) – If True will use bonds read from files.
guessBonds (bool) – If True will use guessed bonds.
- Returns:
asel – Either a boolean mask of selected atoms or their indexes
- Return type:
np.ndarray
Examples
>>> mol = Molecule("3ptb") >>> mol.atomselect('resname BEN') array([False, False, False, ..., False, False, False], dtype=bool) >>> mask = mol.resname == "BEN" # equivalent to 'resname BEN' >>> mol.atomselect(mask, indexes=True) # boolean mask -> indices array([1630, 1631, 1632, 1633, 1634, 1635, 1636, 1637, 1638], dtype=uint32) >>> mask = (mol.resname == "BEN") & (mol.name == "C4") # equivalent to 'resname BEN and name C4' >>> mol.atomselect(mask) array([False, False, False, ..., False, False, False]) >>> assert np.array_equal(mol.atomselect(mask), mol.atomselect("resname BEN and name C4")) >>> mol.atomselect(np.array([0, 1, 2])) # integer indices -> boolean mask array([ True, True, True, ..., False, False, False]) >>> mol2 = mol.copy() >>> _ = mol2.filter(mol2.resname == "BEN") # same short-circuit works for any sel-taking method >>> mol2.numAtoms 9 >>> mol.copy(sel=mol.resname == "BEN").numAtoms # and for copy(sel=...) 9
- property boxvectors: ndarray#
The box vectors of the Molecule
- center(loc=(0, 0, 0), sel='all')#
Moves the geometric center of the Molecule to a given location
- Parameters:
- Returns:
translation – 3D coordinates of the translation applied to the Molecule
- Return type:
np.ndarray
Examples
>>> mol=tryp.copy() >>> mol.center() >>> mol.center([10, 10, 10], 'name CA')
- copy(frames=None, sel=None)#
Create a copy of the Molecule object
- Returns:
newmol (
Molecule) – A copy of the objectframes (list of int) – If specified, only the selected frames will be copied.
sel (str) – Atom selection for atoms to keep in the copy.
- crystalinfo: dict#
A dictionary containing crystallographic information. It has fields [‘sGroup’, ‘numcopies’, ‘rotations’, ‘translations’]
- deleteBonds(sel, inter=True)#
Deletes all bonds that contain atoms in sel or between atoms in sel.
- dropFrames(drop=None, keep=None)#
Removes trajectory frames from the Molecule
- Parameters:
Examples
>>> mol = Molecule('1sb0') >>> mol.dropFrames(keep=[1,2]) >>> mol.numFrames == 2 True >>> mol.dropFrames(drop=[0]) >>> mol.numFrames == 1 True
- empty(numAtoms, numFrames=0)#
Creates an empty molecule of numAtoms atoms.
- Parameters:
Example
>>> newmol = Molecule().empty(100)
- extendResidueFromSmiles(sel: str, extension_smiles: str | None = None, target_atom_sel: str | None = None, new_smiles: str | None = None, sanitizeSmiles: bool = True, minimize: bool = False, _logger: bool = True)#
Extend a residue with a SMILES string
Two modes are supported (mutually exclusive):
Extension SMILES mode: provide
extension_smiles(with a dummy atom*) andtarget_atom_selto attach a moiety at a specific atom.New SMILES mode: provide
new_smileswith the complete SMILES of the modified molecule. MCS matching is used to identify unchanged atoms and generate 3D coordinates for the new ones.
This function requires that the residue already has bond orders assigned and is protonated, which can be achieved by using templateResidueFromSmiles if needed.
- Parameters:
sel (str) – The atom selection of the residue which we want to extend
extension_smiles (str, optional) – The SMILES string of the extension moiety with a dummy atom
*target_atom_sel (str, optional) – The atom selection of the target atom to which the extension will be attached (required with extension_smiles)
new_smiles (str, optional) – Complete SMILES of the modified molecule (alternative to extension_smiles)
sanitizeSmiles (bool) – If True the SMILES string will be sanitized
minimize (bool) – If True and OpenMM is available, run a soft-potential energy minimization of the residue against its surroundings after insertion.
_logger (bool) – If True the logger will be used to print information
Examples
>>> mol = Molecule('3ptb') >>> mol.templateResidueFromSmiles("resname BEN", "[NH2+]=C(N)c1ccccc1", addHs=True) >>> mol.extendResidueFromSmiles("resname BEN", extension_smiles="*C(C)(C)C", target_atom_sel="resname BEN and name H6")
Or equivalently using the full modified SMILES:
>>> mol = Molecule('3ptb') >>> mol.templateResidueFromSmiles("resname BEN", "[NH2+]=C(N)c1ccccc1", addHs=True) >>> mol.extendResidueFromSmiles("resname BEN", new_smiles="[NH2+]=C(N)c1cc(C(C)(C)C)ccc1")
- filter(sel, _logger=True)#
Removes all atoms not included in the selection
- Parameters:
- Returns:
removed – An array of all atoms which did not belong to sel and were removed from the Molecule object
- Return type:
np.ndarray
Examples
>>> mol=tryp.copy() >>> mol.filter('protein')
- property frame#
The currently active frame of the Molecule on which methods will be applied
- static fromDict(moldict)#
- static fromOpenMMTopology(topology, positions)#
Converts an OpenMM topology and positions to a Molecule object
- Parameters:
topology (openmm.app.Topology) – The OpenMM topology to convert
positions (openmm.unit.Quantity) – The positions of the atoms in the topology
Examples
>>> from openmm import app >>> from openmm import unit >>> pdbfile = app.PDBFile("3ptb.pdb") >>> mol = Molecule.fromOpenMMTopology(pdbfile.topology, pdbfile.positions)
- static fromRDKitMol(rmol)#
Converts an RDKit molecule to a Molecule object
- Parameters:
rmol (rdkit.Chem.rdchem.Mol) – The RDKit molecule to convert
Examples
>>> from rdkit import Chem >>> from rdkit.Chem import AllChem >>> rmol = Chem.MolFromSmiles("C1CCCCC1") >>> rmol = Chem.AddHs(rmol) >>> AllChem.EmbedMolecule(rmol) >>> AllChem.MMFFOptimizeMolecule(rmol) >>> mol = Molecule.fromRDKitMol(rmol)
- property fstep#
The frame-step of the trajectory
- get(field, sel=None, fileBonds=True, guessBonds=True)#
Retrieve a specific PDB field based on the selection
- Parameters:
field (str) – The field we want to get. To see a list of all available fields do print(Molecule._atom_and_coord_fields).
sel (str) – Atom selection string for which atoms we want to get the field from. Default all. See more here
fileBonds (bool) – If True will use bonds read from files.
guessBonds (bool) – If True will use guessed bonds. Both fileBonds and guessBonds can be combined.
- Returns:
vals – Array of values of field for all atoms in the selection.
- Return type:
np.ndarray
Examples
>>> mol=tryp.copy() >>> mol.get('resname') array(['ILE', 'ILE', 'ILE', ..., 'HOH', 'HOH', 'HOH'], dtype=object) >>> mol.get('resname', sel='resid 158') array(['LEU', 'LEU', 'LEU', 'LEU', 'LEU', 'LEU', 'LEU', 'LEU'], dtype=object)
- getCenter(sel='all', com=False)#
Get the center of an atom selection
- getDihedral(atom_quad)#
Get the value of a dihedral angle.
- Parameters:
atom_quad (list) – Four atom indexes corresponding to the atoms defining the dihedral
- Returns:
angle – The angle in radians
- Return type:
Examples
>>> mol.getDihedral([0, 5, 8, 12])
- getNeighbors(idx, bonds=None)#
Returns all atoms bonded to a specific atom
- getResidues(fields=('resid', 'insertion', 'chain'), sel='all', return_idx=True)#
Get unique ids for the residues of the Molecule
- Parameters:
fields (np.ndarray or tuple) – An array of Molecule attributes. Once a change in any of the fields happens, a new ID will be created in residues. The default fields are (“resid”, “insertion”, “chain”) which means that a new residue ID will be created if the resid or insertion or chain changes from the previous atom to the next one.
sel (str) – Atomselection for which to return the residues. Default is “all”. See more here
return_idx (bool) – If set to True, the method will return the indices of each unique residue
- Returns:
residues (np.ndarray) – An array of unique ids for the residues
idx (list) – A list of arrays, each containing the indices corresponding to the unique values in residues. Will only be returned if return_idx is set to True.
Examples
>>> mol = Molecule('5zmz') >>> residues, idx = mol.getResidues() >>> residues array([0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 1, 1, 1, 1, 2, 2, 2, 2, 2, 2, 2, 2, 3, 3, 3, 3, 3, 4]) >>> idx [array([0, 1, 2, 3, 4, 5, 6, 7]), array([ 8, 9, 10, 11, 12, 13, 14, 15, 16]), array([17, 18, 19, 20, 21, 22, 23, 24]), array([25, 26, 27, 28, 29]), array([30])]
- getSequence(one_letter=True, dict_key='chain', return_idx=False, sel='all', _logger=True)#
Return the aminoacid sequence of the Molecule.
- Parameters:
one_letter (bool) – Whether to return one-letter or three-letter AA codes. There should be only one atom per residue.
dict_key (str | None) – If None, the function will return a dictionary with keys “protein” and “nucleic” (if they exist) and the concatenated sequence as the value. If “chain” or “segid” is passed, the function will return a dictionary with the sequence of each chain or segment.
return_idx (bool) – If True, the function also returns the indexes of the atoms of each residue in the sequence
sel (str) – Atomselection for which to return the sequence
- Returns:
sequence – The primary sequence as a dictionary.
- Return type:
Examples
>>> mol = Molecule("3PTB") >>> mol.getSequence() {'A': 'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'} >>> mol.getSequence(sel="resid 16 to 50") {'A': 'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQ'} >>> mol = Molecule("1LKK") >>> seq = mol.getSequence(one_letter=False, dict_key="chain") >>> seq.keys() dict_keys(['A', 'B']) >>> seq['B'] ['PTR', 'GLU', 'GLU', 'ILE'] >>> seq = mol.getSequence(one_letter=True, dict_key="chain") >>> seq['B'] 'XEEI' >>> seq = mol.getSequence(one_letter=True, dict_key="segid") >>> seq.keys() dict_keys(['1', '2']) >>> seq, idx = mol.getSequence(return_idx=True) >>> idx['B'][-1] # The atom indexes of the last residue in chain B array([1718, 1719, 1720, 1721, 1722, 1723, 1724, 1725, 1726, 1727, 1728, 1729, 1730, 1731, 1732, 1733, 1734, 1735, 1736, 1737])
- guessBonds(rdkit=False)#
- hasBond(idx1, idx2)#
Checks if the Molecule has a bond between two atom indexes
- insert(mol, index, collisions=False, coldist=1.3, removesel='all', invertcollisions=False)#
Insert the atoms of one molecule into another at a specific index.
- Parameters:
mol (
Molecule) – Molecule to be insertedindex (integer) – The atom index at which the passed molecule will be inserted
collisions (bool) – If set to True it will remove residues of mol which collide with atoms of this Molecule object.
coldist (float) – Collision distance in Angstrom between atoms of the two molecules. Anything closer will be considered a collision.
removesel (str) – Atomselection for atoms to be removed from the molecule in case of collisions.
invertcollisions (bool) – If invertcollisions is set to True it will remove residues of this Molecule which collide with atoms of the passed mol molecule.
Example
>>> mol=tryp.copy() >>> mol.numAtoms 1701 >>> mol.insert(tryp, 0) >>> mol.numAtoms 3402
- moveBy(vector, sel=None)#
- mutateResidue(sel, newres, reconstruct=True, rotamer_mode='best', minimize=False)#
Mutate a residue, optionally reconstructing the side-chain.
When reconstruct is True (the default) the old side-chain is removed and a new one is built from ideal geometry, placed using the Dunbrack backbone-dependent rotamer library, and optionally refined with an OpenMM soft-potential energy minimization.
- Parameters:
sel (str) – Atom selection string for the residue we want to mutate. The selection needs to include all atoms of the residue. See more here
newres (str) – The three-letter code of the target residue.
reconstruct (bool, optional) – If True (default), fully reconstruct the new side-chain. If False, use legacy behaviour (strip side-chain and rename).
rotamer_mode (str, optional) – How to choose the rotamer.
"best"(default) picks the rotamer with the lowest VdW clash energy against surrounding atoms."first"picks the most probable rotamer."random"samples a rotamer weighted by probability.minimize (bool, optional) – If True and OpenMM is installed, run a soft-potential energy minimization after side-chain placement. Default False.
Examples
>>> mol=tryp.copy() >>> mol.mutateResidue('resid 158', 'ARG')
- property numAtoms#
Number of atoms in the molecule
- property numBonds#
Number of bonds in the molecule
- property numFrames#
Number of coordinate frames in the molecule
- read(filename, type=None, skip=None, frames=None, append=False, overwrite='all', keepaltloc='A', guess=None, guessNE=None, _logger=True, **kwargs)#
Read topology, coordinates and trajectory files in multiple formats.
Detects from the extension the file type and loads it into Molecule
- Parameters:
filename (str) – Name of the file we want to read
type (str, optional) – File type of the file. If None, it’s automatically determined by the extension
skip (int, optional) – If the file is a trajectory, skip every skip frames
frames (list, optional) – If the file is a trajectory, read only the given frames
append (bool, optional) – If the file is a trajectory or coor file, append the coordinates to the previous coordinates. Note append is slow.
overwrite (str, list of str) – A list of the existing fields in Molecule that we wish to overwrite when reading this file. Set to None if you don’t want to overwrite any existing fields.
keepaltloc (str) – Set to any string to only keep that specific altloc. Set to ‘all’ if you want to keep all alternative atom positions.
guess (list of str) – Properties of the molecule to guess. Can be any combination of (‘bonds’, ‘angles’, ‘dihedrals’)
guessNE (list of str) – Properties of the molecule to guess if it’s Non-Existent. Can be any combination of (‘bonds’, ‘angles’, ‘dihedrals’)
- record: ndarray[Any, dtype[object_]]#
The record field of a PDB file if the topology was read from a PDB.
- remove(selection, _logger=True)#
Remove atoms from the Molecule
- Parameters:
selection (str) – Atom selection string of the atoms we want to remove. See more here
- Returns:
removed – The list of atoms removed
- Return type:
np.array
Example
>>> mol=tryp.copy() >>> mol.remove('name CA') array([ 1, 9, 16, 20, 24, 36, 43, 49, 53, 58,...
- removeBond(idx1, idx2)#
Remove an existing bond between a pair of atoms
- renumberResidues(returnMapping=False, start=0, modulo=None)#
Renumbers protein residues incrementally.
It checks for changes in either of the resid, insertion, chain or segid fields and in case of a change it creates a new residue number.
- Parameters:
returnMapping (bool) – If set to True, the method will also return the mapping between the old and new residues
Examples
>>> mapping = mol.renumberResidues(returnMapping=True)
- reorderAtoms(order)#
Reorder atoms in Molecule
Changes the order of atoms in the Molecule to the defined order.
- Parameters:
order (list) – A list containing the new order of atoms
Examples
>>> mol = Molecule() >>> _ = mol.empty(4) >>> mol.name[:] = ['N', 'C', 'H', 'S'] >>> neworder = [1, 3, 2, 0] >>> mol.reorderAtoms(neworder) >>> print(mol.name) ['C' 'S' 'H' 'N']
- reps: Representations#
A list of representations that is used when visualizing the molecule
- rotateBy(M, center=(0, 0, 0), sel='all')#
Rotate a selection of atoms by a given rotation matrix around a center
- Parameters:
Examples
>>> from moleculekit.util import rotationMatrix >>> mol = tryp.copy() >>> mol.rotateBy(rotationMatrix([0, 1, 0], 1.57))
- sequence(oneletter=True, noseg=False, return_idx=False, sel='all', _logger=True)#
DEPRECATED: Use getSequence instead.
- set(field, value, sel=None)#
Set the values of a Molecule field based on the selection
- Parameters:
field (str) – The field we want to set. To see a list of all available fields do print(Molecule._atom_and_coord_fields).
value (string or integer) – All atoms that match the atom selection will have the field field set to this scalar value (or 3-vector if setting the coordinates)
sel (str) – Atom selection string for atom which to set. See more here
Examples
>>> mol=tryp.copy() >>> mol.set('segid', 'P', sel='protein')
- setDihedral(atom_quad, radians, bonds=None, guessBonds=False)#
Sets the angle of a dihedral.
- Parameters:
atom_quad (list) – Four atom indexes corresponding to the atoms defining the dihedral
radians (float) – The angle in radians to which we want to set the dihedral
bonds (np.ndarray) – An array containing all bonds of the molecule. This is needed if multiple modifications are done as the bond guessing can get messed up if atoms come very close after the rotation.
guessBonds (bool) – Set to True if you want to guess bonds based on atom distances if they are not defined
Examples
>>> mol.setDihedral([0, 5, 8, 12], 0.16) >>> # If we perform multiple modifications, calculate bonds first and pass them as argument to be safe >>> bonds = mol._getBonds() >>> mol.setDihedral([0, 5, 8, 12], 0.16, bonds=bonds) >>> mol.setDihedral([18, 20, 24, 30], -1.8, bonds=bonds)
- templateResidueFromSmiles(sel, smiles, sanitizeSmiles=True, addHs=False, onlyOnAtoms=None, guessBonds=False, _logger=True)#
Assign bonds, bond orders, formal charges and (optionally) hydrogens to a residue from a SMILES template.
Uses RDKit’s Maximum Common Substructure (MCS) matching between the residue’s current bond graph and the SMILES template to transfer bond orders and formal charges. The molecule is mutated in place: the matched residue’s atoms are replaced by the templated copy.
Multiple residues can be templated in one call when
selspans several copies (e.g."resname NAG"for several NAG residues, or a boolean mask covering multiple chain residues). Each residue is templated individually with the same SMILES, in residue order.Cross-residue covalent bonds (peptide N-C, nucleic acid phosphodiester P-O3’, and any bond already present in
mol.bondsthat crosses the residue boundary) are detected and the boundary atoms’ H counts are reduced accordingly soaddHs=Truedoes not over-protonate them. Ifmol.bondsis empty for the residue, passguessBonds=Trueto populate it via distance-based guessing.If the SMILES template has heavy atoms that don’t map onto the residue (typically a leaving group displaced by a covalent link, or the terminal -OH / -OXT on a mid-chain amino acid SMILES), the function attempts to strip those terminal atoms automatically and retry the MCS match. If the mismatch can’t be resolved this way, a
RuntimeErroris raised.- Parameters:
sel (str or numpy.ndarray) – VMD-style atom selection or boolean mask of the residue(s) to template. May span multiple residues with the same chemistry.
smiles (str) – SMILES string of the template residue. RCSB-style ligand SMILES (i.e. fully protonated, with explicit formal charges and the full set of heavy atoms) work best.
sanitizeSmiles (bool) – If True, the SMILES is sanitized by RDKit before matching.
addHs (bool) – If True, hydrogens are added to the residue using RDKit’s
AddHsafter bond orders are transferred, respecting the boundary-bond H-count corrections described above.onlyOnAtoms (str) – VMD-style selection within the residue restricting which heavy atoms get hydrogens added. Only used when
addHs=True.guessBonds (bool) – If True, run distance-based bond guessing on the residue before templating. Use this when
mol.bondsis empty for the selection (e.g. PDB inputs without CONECT records)._logger (bool) – If False, suppress informational logging.
- Raises:
RuntimeError – If the selection is empty, spans multiple residues with gaps in atom indexes, has no bonds, or the SMILES contains heavy atoms that cannot be matched (even after auto-stripping recognized terminal atoms).
Examples
>>> mol = Molecule("3ptb") >>> mol.templateResidueFromSmiles("resname BEN", "[NH2+]=C(N)c1ccccc1", addHs=True) >>> mol.templateResidueFromSmiles("resname GLY and resid 18", "C(C(=O))N", addHs=True)
Template every copy of a sugar at once (each residue templated individually with the same SMILES):
>>> mol.templateResidueFromSmiles( ... "resname NAG", ... "CC(=O)NC1C(O)C(O)C(CO)OC1O", ... addHs=True, ... )
- toDict(fields=None)#
Returns a dictionary representation of the molecule
- toGraph(fields=None, distances=False)#
Converts the Molecule to a networkx graph.
Each node corresponds to an atom and edges correspond to bonds
- toOpenFFMolecule(sanitize=False, kekulize=False, assignStereo=True)#
- toRDKitMol(sanitize=False, kekulize=False, assignStereo=True, guessBonds=False, _logger=True)#
Converts the Molecule to an RDKit molecule
- Parameters:
sanitize (bool) – If True the molecule will be sanitized
kekulize (bool) – If True the molecule will be kekulized
assignStereo (bool) – If True the molecule will have stereochemistry assigned from its 3D coordinates
guessBonds (bool) – If True the molecule will have bonds guessed
_logger (bool) – If True the logger will be used to print information
- translateBy(vector, sel=None)#
Move a selection of atoms by a given vector
- Parameters:
Examples
>>> mol=tryp.copy() >>> mol.moveBy([3, 45 , -8])
- view(sel=None, style=None, color=None, guessBonds=True, viewer=None, hold=False, name=None, viewerhandle=None, gui=False, pmviewurl='http://localhost:8090')#
Visualizes the molecule in a molecular viewer
- Parameters:
sel (str) – Atom selection string for the representation. See more here
color (str or int) – Coloring mode (str) or ColorID (int). See more here.
guessBonds (bool) – Allow the viewer to guess bonds for the molecule
viewer (str ('pmview', 'pymol', 'vmd', 'webgl')) – Choose viewer backend. Default is taken from either moleculekit.config or if it doesn’t exist from moleculekit.config
hold (bool) – If set to True, it will not visualize the molecule but instead collect representations until set back to False.
name (str, optional) – A name to give to the molecule in the viewer
viewerhandle (
VMDobject, optional) – A specific viewer in which to visualize the molecule. If None it will use the current default viewer.pmviewurl (string) – URL of pmview REST server
- wrap(wrapsel='all', fileBonds=True, guessBonds=False, wrapcenter=None, unitcell='rectangular')#
Wraps the coordinates of the molecule into the simulation box
It assumes that all bonded groups are sequential in Molecule. I.e. you don’t have a molecule B in between the atoms of molecule A. It also requires correct bonding (ideally read from a topology file).
- Parameters:
wrapsel (str) – Atom selection string of atoms on which to center the wrapping box. See more here
fileBonds (bool) – Whether to use the bonds read from the file or to guess them
guessBonds (bool) – Whether to guess the bonds. If fileBonds is True these will get appended
wrapcenter (array_like, optional) – The center around which to wrap. If not provided, it will be calculated from the atoms in wrapsel. Normally you want to use the wrapsel option and not the wrapcenter as the coordinates of the selection can change during a simulation and wrapsel will keep that selection in the center for all frames.
unitcell (str) – This option can be used for choosing between different unit cell representations of triclinic boxes. It doesn’t have any effect on rectangular boxes. The wrapping of a triclinic cell can be “rectangular”, “triclinic” or “compact”. Rectangular wrapping is the default and it wraps the box into a parallelepiped. Triclinic wrapping wraps the box into a triclinic box. Compact wrapping wraps the box into a shape that has the minimum volume. This can be useful for visualizing e.g. truncated octahedra or rhombic dodecahedra.
Examples
>>> mol=tryp.copy() >>> mol.wrap() >>> mol.wrap('protein')
- write(filename, sel=None, type=None, **kwargs)#
Writes the topology and coordinates of the Molecule in any of the supported formats.
- Parameters:
- property x#
Get the x coordinates at the current frame
- property y#
Get the y coordinates at the current frame
- property z#
Get the z coordinates at the current frame
- class moleculekit.molecule.UniqueAtomID(**kwargs)#
Bases:
object- static fromMolecule(mol, sel=None, idx=None)#
- selectAtom(mol, indexes=True, ignore=None)#
- class moleculekit.molecule.UniqueResidueID(**kwargs)#
Bases:
object- static fromMolecule(mol, sel=None, idx=None)#
- selectAtoms(mol, indexes=True, ignore=None)#
- moleculekit.molecule.calculateUniqueBonds(bonds, bondtype)#
Given bonds and bondtypes calculates unique bonds dropping any duplicates
- Parameters:
bonds (np.ndarray) – The bonds of a molecule
bondtype (np.ndarray) – The bond type of each bond in the bonds array
- Returns:
uqbonds (np.ndarray) – The unique bonds of the molecule
uqbondtype (np.ndarray) – The corresponding bond types for uqbonds
Examples
>>> from moleculekit.molecule import Molecule >>> mol = Molecule('3PTB') >>> mol.bonds, mol.bondtype = calculateUniqueBonds(mol.bonds, mol.bondtype) # Overwrite the bonds and bondtypes with the unique ones
- moleculekit.molecule.getBondedGroups(mol, bonds=None)#
Calculates all bonded groups in a Molecule
- Parameters:
mol (Molecule) – A Molecule object
bonds (np.ndarray) – Optionally pass a different array of bonds. If None it will take the bonds from mol.bonds.
- Returns:
groups (np.ndarray) – Groups is an array which contains the starting index of each group.
group (np.ndarray) – An array with the group index of each atom
Examples
>>> mol = Molecule("structure.prmtop") >>> mol.read("output.xtc") >>> groups, _ = getBondedGroups(mol) >>> for i in range(len(groups)-1): ... print(f"Group {i} starts at index {groups[i]} and ends at index {groups[i+1]-1}")
- moleculekit.molecule.mol_equal(mol1, mol2, checkFields=('record', 'serial', 'name', 'altloc', 'resname', 'chain', 'resid', 'insertion', 'occupancy', 'beta', 'segid', 'element', 'charge', 'masses', 'atomtype', 'formalcharge', 'virtualsite', 'coords'), exceptFields=None, fieldPrecision=None, dtypes=False, uqBonds=False, _logger=True)#
Compare two Molecules for equality.
- Parameters:
mol1 (Molecule) – The first molecule to compare
mol2 (Molecule) – The second molecule to compare to the first
checkFields (list) – A list of fields to compare. By default compares all atom information and coordinates in the molecule
exceptFields (list) – A list of fields to not compare.
fieldPrecision (dict) – A dictionary of field, precision key-value pairs which defines the numerical precision of the value comparisons of two arrays
dtypes (bool) – Set to True to also compare datatypes of the fields
uqBonds (bool) – Set to True to compare unique bonds instead of all bonds
_logger (bool) – Set to False to disable the printing of the differences in the two Molecules
- Returns:
equal – Returns True if the molecules are equal or False if they are not.
- Return type:
Examples
>>> mol_equal(mol1, mol2, checkFields=['resname', 'resid', 'segid']) >>> mol_equal(mol1, mol2, exceptFields=['record', 'name']) >>> mol_equal(mol1, mol2, fieldPrecision={'coords': 1e-5})