moleculekit.molecule module#

class moleculekit.molecule.Molecule(filename=None, name=None, **kwargs)#

Bases: object

Class to read, write and manipulate molecular structures.

Molecule is the main class of MoleculeKit. It stores all the relevant molecular information for a system and allows many different operations to be performed on it, including adding or removing atoms, bonds, calculating various properties of the system, and visualizing the molecule. Molecule can read a large variety of molecular file formats and convert between them, therefore it can also be used as a molecular file format converter.

Parameters:
  • filename (str | list | None) – Optionally load a PDB file from the specified file. If there’s no file and the value is four characters long assume it is a PDB accession code and try to download from the RCSB web server.

  • name (str | None) – Give a name to the Molecule that will be used for visualization

Examples

>>> mol = Molecule('./test/data/dhfr/dhfr.pdb')
>>> mol = Molecule('3PTB')
>>> print(mol)
Molecule with 1701 atoms and 1 frames
Atom field - altloc shape: (1701,)
Atom field - atomtype shape: (1701,)
...
addBond(idx1, idx2, btype)#

Add a new bond to a pair of atoms

If the bond already exists it will only update it’s type

Parameters:
  • idx1 (int) – The index of the one atom

  • idx2 (int) – The index of the other atom

  • btype (str) – The type of the bond as a string

Examples

>>> mol.addBond(13, 18, "2") # Adds a double bond
align(sel, refmol=None, refsel=None, frames=None, matchingframes=False, mode='index', _logger=True)#

Align conformations.

Align a given set of frames of this molecule to either the current active frame of this molecule (mol.frame) or the current frame of a different reference molecule. To align to any frame other than the current active one modify the refmol.frame property before calling this method.

Parameters:
  • sel (str | ndarray) – An atom selection string, a boolean mask, or an integer index array. Atom selection string for aligning. See more here

  • refmol (Molecule | None) – Optionally pass a reference Molecule on which to align. If None is given, it will align on the first frame of the same Molecule

  • refsel (str | ndarray | None) – An atom selection string, a boolean mask, or an integer index array. Atom selection for the refmol if one is given. Default: same as sel. See more here

  • frames (list | range | ndarray | None) – A list of frames which to align. By default it will align all frames of the Molecule

  • matchingframes (bool) – If set to True it will align the selected frames of this molecule to the corresponding frames of the refmol. This requires both molecules to have the same number of frames.

  • mode (str) – Options are (‘index’, ‘structure’). Setting to ‘index’ will align two structures on the atoms selected in sel and refsel in increasing order of their indices. Meaning that if sel is name CA and resid 5 3 and refsel is name CA and resid 7 8, assuming that resid 3 comes before 5, it will align the CA or resid 3 to resid 7 in refmol and 5 to 8 instead of 5-7, 3-8 as one might expect from the atomselection strings. Setting mode to ‘structure’ will perform pure structural alignment regardless of atom order using the TM-Align method.

Examples

>>> mol=tryp.copy()
>>> mol.align('protein')
>>> mol.align('name CA', refmol=Molecule('3PTB'))
alignBySequence(ref, molseg=None, refseg=None, molsel='all', refsel='all', nalignfragment=1, returnAlignments=False, maxalignments=1)#

Aligns the Molecule to a reference Molecule by their longest sequence alignment

Parameters:
  • ref (Molecule) – The reference Molecule to which we want to align

  • molseg (str | None) – The segment of this Molecule we want to align. If None it will be guessed.

  • refseg (str | None) – The segment of ref we want to align to. If None it will be guessed.

  • molsel (str | ndarray) – An atom selection string, a boolean mask, or an integer index array. The atom selection of this Molecule we want to align

  • refsel (str | ndarray) – An atom selection string, a boolean mask, or an integer index array. The atom selection of ref we want to align to

  • nalignfragment (int) – The number of fragments used for the alignment.

  • returnAlignments (bool) – Return all alignments as a list of Molecules

  • maxalignments (int) – The maximum number of alignments we want to produce

Returns:

mols – If returnAlignments is True it returns a list of Molecules each containing a different alignment. Otherwise it modifies the current Molecule with the best single alignment.

Return type:

list

altloc: Annotated[ndarray[tuple[Any, ...], dtype[object_]], 'Shape: (numAtoms,)']#

The alternative location flag of the atoms if read from a PDB.

angles: Annotated[ndarray[tuple[Any, ...], dtype[uint32]], 'Shape: (numAngles, 3)']#

Atom triplets corresponding to angle terms.

append(mol, collisions=False, coldist=1.3, removesel='all', invertcollisions=False)#

Append a molecule at the end of the current molecule

Parameters:
  • mol (Molecule) – Target Molecule which to append to the end of the current Molecule

  • collisions (bool) – If set to True it will remove residues of mol which collide with atoms of this Molecule object.

  • coldist (float) – Collision distance in Angstrom between atoms of the two molecules. Anything closer will be considered a collision.

  • removesel (str | ndarray) – An atom selection string, a boolean mask, or an integer index array. Atomselection for atoms to be removed from the passed molecule in case of collisions.

  • invertcollisions (bool) – If invertcollisions is set to True it will remove residues of this Molecule which collide with atoms of the passed mol molecule.

Example

>>> mol=tryp.copy()
>>> mol.filter("not resname BEN")
array([1630, 1631, 1632, 1633, 1634, 1635, 1636, 1637, 1638], dtype=int32)
>>> lig=tryp.copy()
>>> lig.filter("resname BEN")
array([   0,    1,    2, ..., 1698, 1699, 1700], dtype=int32)
>>> mol.append(lig)
appendFrames(mol)#

Appends the frames of another Molecule object to this object.

Parameters:

mol (Molecule) – A Molecule object.

atomselect(sel, indexes=False, strict=False, fileBonds=True, guessBonds=True, _debug=False)#

Get a boolean mask or the indexes of a set of selected atoms

Parameters:
  • sel (str | ndarray | None) – Either an atom selection string (see more here), a boolean mask of length numAtoms, or an integer array of atom indices. Non-string inputs short-circuit the selection engine entirely: the array is returned (or converted to the requested form) without any parsing, which lets you reuse a precomputed selection. The same trick works for any other Molecule method that takes an atom selection string (copy, filter, remove, get, etc.) — pass a precomputed boolean mask or index array in place of the string and the call skips re-parsing, which is significantly faster when the same selection is reused many times. The mask or indices must match the current state of the molecule though: any change to the number or order of atoms (e.g. after filter, remove, append, sorting, or adding/removing hydrogens) makes them stale and they will silently refer to the wrong atoms.

  • indexes (bool) – If True returns the indexes instead of a bitmap

  • strict (bool) – If True it will raise an error if no atoms were selected.

  • fileBonds (bool) – If True will use bonds read from files.

  • guessBonds (bool) – If True will use guessed bonds.

Returns:

asel – Either a boolean mask of selected atoms or their indexes

Return type:

ndarray

Examples

>>> mol = Molecule("3ptb")
>>> mol.atomselect('resname BEN')
array([False, False, False, ..., False, False, False], dtype=bool)
>>> mask = mol.resname == "BEN"  # equivalent to 'resname BEN'
>>> mol.atomselect(mask, indexes=True)  # boolean mask -> indices
array([1630, 1631, 1632, 1633, 1634, 1635, 1636, 1637, 1638], dtype=uint32)
>>> mask = (mol.resname == "BEN") & (mol.name == "C4")  # equivalent to 'resname BEN and name C4'
>>> mol.atomselect(mask)
array([False, False, False, ..., False, False, False])
>>> assert np.array_equal(mol.atomselect(mask), mol.atomselect("resname BEN and name C4"))
>>> mol.atomselect(np.array([0, 1, 2]))  # integer indices -> boolean mask
array([ True,  True,  True, ..., False, False, False])
>>> mol2 = mol.copy()
>>> _ = mol2.filter(mol2.resname == "BEN")  # same short-circuit works for any sel-taking method
>>> mol2.numAtoms
9
>>> mol.copy(sel=mol.resname == "BEN").numAtoms  # and for copy(sel=...)
9
atomtype: Annotated[ndarray[tuple[Any, ...], dtype[object_]], 'Shape: (numAtoms,)']#

The atom type of each atom.

beta: Annotated[ndarray[tuple[Any, ...], dtype[float32]], 'Shape: (numAtoms,)']#

The beta factor value of each atom.

bonds: Annotated[ndarray[tuple[Any, ...], dtype[uint32]], 'Shape: (numBonds, 2)']#

Atom pairs corresponding to bond terms.

bondtype: Annotated[ndarray[tuple[Any, ...], dtype[object_]], 'Shape: (numBonds,)']#

The type of each bond in Molecule.bonds if available.

box: Annotated[ndarray[tuple[Any, ...], dtype[float32]], 'Shape: (3, numFrames)']#

The box dimensions of the molecule.

boxangles: Annotated[ndarray[tuple[Any, ...], dtype[float32]], 'Shape: (3, numFrames)']#

The box angles of the molecule.

property boxvectors: Annotated[ndarray, 'Shape: (3, 3, numFrames), dtype: float64']#

The box vectors of the Molecule

center(loc=(0, 0, 0), sel='all')#

Moves the geometric center of the Molecule to a given location

Parameters:
  • loc (list | tuple | ndarray) – The location to which to move the geometric center

  • sel (str | ndarray) – An atom selection string, a boolean mask, or an integer index array. Atom selection string of the atoms whose geometric center we want to center on the loc position. See more here

Returns:

translation – 3D coordinates of the translation applied to the Molecule

Return type:

ndarray

Examples

>>> mol=tryp.copy()
>>> mol.center()
>>> mol.center([10, 10, 10], 'name CA')
chain: Annotated[ndarray[tuple[Any, ...], dtype[object_]], 'Shape: (numAtoms,)']#

The chain name of each atom.

charge: Annotated[ndarray[tuple[Any, ...], dtype[float32]], 'Shape: (numAtoms,)']#

The charge of each atom.

coords: Annotated[ndarray[tuple[Any, ...], dtype[float32]], 'Shape: (numAtoms, 3, numFrames)']#

The coordinates of the atoms.

copy(frames=None, sel=None)#

Create a copy of the Molecule object

Parameters:
  • frames (list | range | ndarray | None) – If specified, only the selected frames will be copied.

  • sel (str | ndarray | None) – An atom selection string, a boolean mask, or an integer index array. Atom selection for atoms to keep in the copy.

Returns:

newmol – A copy of the object

Return type:

Molecule

crystalinfo: dict#

A dictionary containing crystallographic information. It has fields [‘sGroup’, ‘numcopies’, ‘rotations’, ‘translations’]

deleteBonds(sel, inter=True)#

Deletes all bonds that contain atoms in sel or between atoms in sel.

Parameters:
  • sel (str | ndarray) – An atom selection string, a boolean mask, or an integer index array. Atom selection string of atoms whose bonds will be deleted. See more here

  • inter (bool) – When True it will delete also bonds between atoms in sel with bonds to atoms outside of sel. When False it will only delete bonds between atoms in sel.

dihedrals: Annotated[ndarray[tuple[Any, ...], dtype[uint32]], 'Shape: (numDihedrals, 4)']#

Atom quadruplets corresponding to dihedral terms.

dropFrames(drop=None, keep=None)#

Removes trajectory frames from the Molecule

Parameters:
  • drop (int | list | ndarray | None) – Index of frame, or list of frame indexes which we want to drop (and keep all others). By default it will remove all frames from the Molecule.

  • keep (int | list | ndarray | str | None) – Index of frame, or list of frame indexes which we want to keep (and drop all others).

Examples

>>> mol = Molecule('1sb0')
>>> mol.dropFrames(keep=[1,2])
>>> mol.numFrames == 2
True
>>> mol.dropFrames(drop=[0])
>>> mol.numFrames == 1
True
element: Annotated[ndarray[tuple[Any, ...], dtype[object_]], 'Shape: (numAtoms,)']#

The element of each atom.

empty(numAtoms, numFrames=0)#

Creates an empty molecule of numAtoms atoms.

Parameters:
  • numAtoms (int) – Number of atoms to create in the molecule.

  • numFrames (int) – Number of empty trajectory frames to create in the molecule. Default is 0.

Example

>>> newmol = Molecule().empty(100)
extendResidueFromSmiles(sel, extension_smiles=None, target_atom_sel=None, new_smiles=None, sanitizeSmiles=True, minimize=False, _logger=True)#

Extend a residue with a SMILES string

Two modes are supported (mutually exclusive):

  1. Extension SMILES mode: provide extension_smiles (with a dummy atom *) and target_atom_sel to attach a moiety at a specific atom.

  2. New SMILES mode: provide new_smiles with the complete SMILES of the modified molecule. MCS matching is used to identify unchanged atoms and generate 3D coordinates for the new ones.

This function requires that the residue already has bond orders assigned and is protonated, which can be achieved by using templateResidueFromSmiles if needed.

Parameters:
  • sel (str | ndarray) – An atom selection string, a boolean mask, or an integer index array. The atom selection of the residue which we want to extend

  • extension_smiles (str | None) – The SMILES string of the extension moiety with a dummy atom *

  • target_atom_sel (str | ndarray | None) – An atom selection string, a boolean mask, or an integer index array. The atom selection of the target atom to which the extension will be attached (required with extension_smiles)

  • new_smiles (str | None) – Complete SMILES of the modified molecule (alternative to extension_smiles)

  • sanitizeSmiles (bool) – If True the SMILES string will be sanitized

  • minimize (bool) – If True and OpenMM is available, run a soft-potential energy minimization of the residue against its surroundings after insertion.

Examples

>>> mol = Molecule('3ptb')
>>> mol.templateResidueFromSmiles("resname BEN", "[NH2+]=C(N)c1ccccc1", addHs=True)
>>> mol.extendResidueFromSmiles("resname BEN", extension_smiles="*C(C)(C)C", target_atom_sel="resname BEN and name H6")

Or equivalently using the full modified SMILES:

>>> mol = Molecule('3ptb')
>>> mol.templateResidueFromSmiles("resname BEN", "[NH2+]=C(N)c1ccccc1", addHs=True)
>>> mol.extendResidueFromSmiles("resname BEN", new_smiles="[NH2+]=C(N)c1cc(C(C)(C)C)ccc1")
fileloc: Annotated[list, 'Shape: (numFrames, 2)']#

The location of the files used to read this Molecule

filter(sel, _logger=True)#

Removes all atoms not included in the selection

This modifies the current Molecule in-place.

Parameters:

sel (str | ndarray) – Atom selection string, or a boolean array (one element per atom) flagging the atoms to keep. See more here

Returns:

removed – An array of all atoms which did not belong to sel and were removed from the Molecule object

Return type:

ndarray

Examples

>>> mol=tryp.copy()
>>> mol.filter('protein')
formalcharge: Annotated[ndarray[tuple[Any, ...], dtype[int32]], 'Shape: (numAtoms,)']#

The formal charge of each atom.

property frame: int#

The currently active frame of the Molecule on which methods will be applied.

Returns:

frame – The index of the currently active frame.

Return type:

int

Raises:

RuntimeError – If the active frame is out of range for the current number of frames.

static fromDict(moldict)#

Create a Molecule from a dictionary representation.

This is the inverse of toDict().

Parameters:

moldict (dict) – A dictionary mapping Molecule field names to their values, such as the one produced by toDict().

Returns:

mol – A new Molecule populated with the fields from moldict.

Return type:

Molecule

static fromOpenMMTopology(topology, positions)#

Converts an OpenMM topology and positions to a Molecule object

Parameters:
  • topology (Topology) – The OpenMM topology to convert

  • positions (Quantity) – The positions of the atoms in the topology

Examples

>>> from openmm import app
>>> from openmm import unit
>>> pdbfile = app.PDBFile("3ptb.pdb")
>>> mol = Molecule.fromOpenMMTopology(pdbfile.topology, pdbfile.positions)
static fromRDKitMol(rmol)#

Converts an RDKit molecule to a Molecule object

Parameters:

rmol (Mol) – The RDKit molecule to convert

Examples

>>> from rdkit import Chem
>>> from rdkit.Chem import AllChem
>>> rmol = Chem.MolFromSmiles("C1CCCCC1")
>>> rmol = Chem.AddHs(rmol)
>>> AllChem.EmbedMolecule(rmol)
>>> AllChem.MMFFOptimizeMolecule(rmol)
>>> mol = Molecule.fromRDKitMol(rmol)
property fstep#

The frame-step of the trajectory

get(field, sel=None, fileBonds=True, guessBonds=True)#

Retrieve a specific PDB field based on the selection

Parameters:
  • field (str) – The field we want to get. To see a list of all available fields do print(Molecule._atom_and_coord_fields). The special value ‘index’ returns the 0-based atom indices of the selected atoms.

  • sel (str | ndarray | None) – An atom selection string, a boolean mask, or an integer index array. Atom selection string for which atoms we want to get the field from. Default all. See more here

  • fileBonds (bool) – If True will use bonds read from files.

  • guessBonds (bool) – If True will use guessed bonds. Both fileBonds and guessBonds can be combined.

Returns:

vals – Array of values of field for all atoms in the selection. If field is ‘index’ it returns the 0-based indices of the selected atoms.

Return type:

ndarray

Examples

>>> mol=tryp.copy()
>>> mol.get('resname')
array(['ILE', 'ILE', 'ILE', ..., 'HOH', 'HOH', 'HOH'], dtype=object)
>>> mol.get('resname', sel='resid 158')
array(['LEU', 'LEU', 'LEU', 'LEU', 'LEU', 'LEU', 'LEU', 'LEU'], dtype=object)
getCenter(sel='all', com=False)#

Get the center of an atom selection

Parameters:
  • sel (str | ndarray) – An atom selection string, a boolean mask, or an integer index array. Atom selection string for which to calculate the center of mass

  • com (bool) – If True it will calculate the center of mass. If False it will calculate the geometric center.

Returns:

center – The center of mass or geometric center of the selection

Return type:

ndarray

getDihedral(atom_quad)#

Get the value of a dihedral angle.

Parameters:

atom_quad (list) – Four atom indexes corresponding to the atoms defining the dihedral

Returns:

angle – The angle in radians

Return type:

float

Examples

>>> mol.getDihedral([0, 5, 8, 12])
getNeighbors(idx, bonds=None)#

Returns all atoms bonded to a specific atom

Parameters:
  • idx (int) – The atom for which to find bonded atoms

  • bonds (ndarray | None) – Override the bonds stored in the Molecule object

Returns:

atoms – The atoms bonded to idx

Return type:

list of int

Raises:
  • TypeError – If idx is not an integer. Atom selection strings are not accepted, use mol.atomselect(sel, indexes=True) to convert them.

  • IndexError – If idx does not point to an atom of this Molecule

getResidues(fields=('resid', 'insertion', 'chain'), sel='all', return_idx=True)#

Get unique ids for the residues of the Molecule

Parameters:
  • fields (tuple | ndarray) – An array of Molecule attributes. Once a change in any of the fields happens, a new ID will be created in residues. The default fields are (“resid”, “insertion”, “chain”) which means that a new residue ID will be created if the resid or insertion or chain changes from the previous atom to the next one.

  • sel (str | ndarray) – An atom selection string, a boolean mask, or an integer index array. Atomselection for which to return the residues. Default is “all”. See more here

  • return_idx (bool) – If set to True, the method will return the indices of each unique residue

Returns:

  • residues (numpy.ndarray) – An array of unique ids for the residues

  • idx (list) – A list of arrays, each containing the indices corresponding to the unique values in residues. Will only be returned if return_idx is set to True.

Examples

>>> mol = Molecule('5zmz')
>>> residues, idx = mol.getResidues()
>>> residues
array([0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 1, 1, 1, 1, 2, 2, 2, 2, 2,
       2, 2, 2, 3, 3, 3, 3, 3, 4])
>>> idx
[array([0, 1, 2, 3, 4, 5, 6, 7]),
 array([ 8,  9, 10, 11, 12, 13, 14, 15, 16]),
 array([17, 18, 19, 20, 21, 22, 23, 24]),
 array([25, 26, 27, 28, 29]),
 array([30])]
getSequence(one_letter=True, dict_key='chain', return_idx=False, sel='all', _logger=True)#

Return the aminoacid sequence of the Molecule.

Parameters:
  • one_letter (bool) – Whether to return one-letter or three-letter AA codes. There should be only one atom per residue.

  • dict_key (str | None) – If None, the function will return a dictionary with keys “protein” and “nucleic” (if they exist) and the concatenated sequence as the value. If “chain” or “segid” is passed, the function will return a dictionary with the sequence of each chain or segment.

  • return_idx (bool) – If True, the function also returns the indexes of the atoms of each residue in the sequence

  • sel (str | ndarray | None) – Atomselection for which to return the sequence

Returns:

sequence – The primary sequence as a dictionary.

Return type:

str

Examples

>>> mol = Molecule("3PTB")
>>> mol.getSequence()
{'A': 'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'}
>>> mol.getSequence(sel="resid 16 to 50")
{'A': 'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQ'}
>>> mol = Molecule("1LKK")
>>> seq = mol.getSequence(one_letter=False, dict_key="chain")
>>> seq.keys()
dict_keys(['A', 'B'])
>>> seq['B']
['PTR', 'GLU', 'GLU', 'ILE']
>>> seq = mol.getSequence(one_letter=True, dict_key="chain")
>>> seq['B']
'XEEI'
>>> seq = mol.getSequence(one_letter=True, dict_key="segid")
>>> seq.keys()
dict_keys(['1', '2'])
>>> seq, idx = mol.getSequence(return_idx=True)
>>> idx['B'][-1] # The atom indexes of the last residue in chain B
array([1718, 1719, 1720, 1721, 1722, 1723, 1724, 1725, 1726, 1727, 1728,
       1729, 1730, 1731, 1732, 1733, 1734, 1735, 1736, 1737])
guessBonds(rdkit=False)#

Guess the bonds of the Molecule and store them in-place.

Computes the bonds (and bond types) from the atom coordinates of the currently active frame and overwrites the bonds and bondtype fields of this Molecule with the result.

Parameters:

rdkit (bool) – If True, use RDKit to guess bonds, which also assigns bond orders. If False, use the distance-based bond guesser and assign all bonds an unknown (‘un’) bond type.

Examples

>>> mol = Molecule("3PTB")
>>> mol.guessBonds()
hasBond(idx1, idx2)#

Checks if the Molecule has a bond between two atom indexes

Parameters:
  • idx1 (int) – The index of the one atom

  • idx2 (int) – The index of the other atom

Returns:

  • has (bool) – True if the Molecule has that bond, False if not

  • btype (str) – The bond type of that bond

  • bidx (int) – The index of that bond in the bond/bondtype array

Raises:
  • TypeError – If an index is not an integer. Atom selection strings are not accepted, use mol.atomselect(sel, indexes=True) to convert them.

  • IndexError – If an index does not point to an atom of this Molecule

impropers: Annotated[ndarray[tuple[Any, ...], dtype[uint32]], 'Shape: (numImpropers, 4)']#

Atom quadruplets corresponding to improper dihedral terms.

insert(mol, index, collisions=False, coldist=1.3, removesel='all', invertcollisions=False)#

Insert the atoms of one molecule into another at a specific index.

This modifies the current Molecule in-place.

Parameters:
  • mol (Molecule) – Molecule to be inserted

  • index (int) – The atom index at which the passed molecule will be inserted

  • collisions (bool) – If set to True it will remove residues which collide with atoms of the other molecule.

  • coldist (float) – Collision distance in Angstrom between atoms of the two molecules. Anything closer will be considered a collision.

  • removesel (str | ndarray) – An atom selection string, a boolean mask, or an integer index array. Atomselection restricting which atoms are considered when detecting collisions. When invertcollisions is False it selects atoms of the passed mol; when invertcollisions is True it selects atoms of this Molecule.

  • invertcollisions (bool) – If False (default), residues of the passed mol which collide with atoms of this Molecule are removed before insertion. If True, residues of this Molecule which collide with atoms of the passed mol are removed instead.

Example

>>> mol=tryp.copy()
>>> mol.numAtoms
1701
>>> mol.insert(tryp, 0)
>>> mol.numAtoms
3402
insertion: Annotated[ndarray[tuple[Any, ...], dtype[object_]], 'Shape: (numAtoms,)']#

The insertion flag of the atoms if read from a PDB.

masses: Annotated[ndarray[tuple[Any, ...], dtype[float32]], 'Shape: (numAtoms,)']#

The mass of each atom.

moveBy(vector, sel=None)#

Move a selection of atoms by a given vector.

Alias of translateBy().

Parameters:
  • vector (list) – 3D coordinates to add to the Molecule coordinates

  • sel (str | ndarray | None) – An atom selection string, a boolean mask, or an integer index array. Atom selection string of atoms which we want to move. See more here

Examples

>>> mol=tryp.copy()
>>> mol.moveBy([3, 45 , -8])
mutateResidue(sel, newres, reconstruct=True, rotamer_mode='best', minimize=False)#

Mutate a residue, optionally reconstructing the side-chain.

When reconstruct is True (the default) the old side-chain is removed and a new one is built from ideal geometry, placed using the Dunbrack backbone-dependent rotamer library, and optionally refined with an OpenMM soft-potential energy minimization.

Parameters:
  • sel (str | ndarray) – An atom selection string, a boolean mask, or an integer index array. Atom selection string for the residue we want to mutate. The selection needs to include all atoms of the residue. See more here

  • newres (str) – The three-letter code of the target residue.

  • reconstruct (bool) – If True (default), fully reconstruct the new side-chain. If False, use legacy behaviour (strip side-chain and rename).

  • rotamer_mode (str) – How to choose the rotamer. "best" (default) picks the rotamer with the lowest VdW clash energy against surrounding atoms. "first" picks the most probable rotamer. "random" samples a rotamer weighted by probability.

  • minimize (bool) – If True and OpenMM is installed, run a soft-potential energy minimization after side-chain placement. Default False.

Examples

>>> mol=tryp.copy()
>>> mol.mutateResidue('resid 158', 'ARG')
name: Annotated[ndarray[tuple[Any, ...], dtype[object_]], 'Shape: (numAtoms,)']#

The name of each atom.

property numAtoms#

Number of atoms in the molecule

property numBonds#

Number of bonds in the molecule

property numFrames#

Number of coordinate frames in the molecule

property numResidues: int#

The number of residues in the Molecule

occupancy: Annotated[ndarray[tuple[Any, ...], dtype[float32]], 'Shape: (numAtoms,)']#

The occupancy value of each atom if read from a PDB.

read(filename, type=None, skip=None, frames=None, append=False, overwrite='all', keepaltloc='A', guess=None, guessNE=None, _logger=True, **kwargs)#

Read topology, coordinates and trajectory files in multiple formats.

Detects from the extension the file type and loads it into Molecule

Parameters:
  • filename (str) – Name of the file we want to read

  • type (str | None) – File type of the file. If None, it’s automatically determined by the extension

  • skip (int | None) – If the file is a trajectory, skip every skip frames

  • frames (list | range | ndarray | None) – If the file is a trajectory, read only the given frames

  • append (bool) – If the file is a trajectory or coor file, append the coordinates to the previous coordinates. Note append is slow.

  • overwrite (str | list) – A list of the existing fields in Molecule that we wish to overwrite when reading this file. Set to None if you don’t want to overwrite any existing fields.

  • keepaltloc (str) – Set to any string to only keep that specific altloc. Set to ‘all’ if you want to keep all alternative atom positions.

  • guess (list | None) – Properties of the molecule to guess. Can be any combination of (‘bonds’, ‘angles’, ‘dihedrals’)

  • guessNE (list | None) – Properties of the molecule to guess if it’s Non-Existent. Can be any combination of (‘bonds’, ‘angles’, ‘dihedrals’)

record: Annotated[ndarray[tuple[Any, ...], dtype[object_]], 'Shape: (numAtoms,)']#

The record field of a PDB file if the topology was read from a PDB.

remove(selection, _logger=True)#

Remove atoms from the Molecule

Parameters:

selection (str | ndarray) – An atom selection string, a boolean mask, or an integer index array. Atom selection string of the atoms we want to remove. See more here

Returns:

removed – The list of atoms removed

Return type:

ndarray

Example

>>> mol=tryp.copy()
>>> mol.remove('name CA')
array([   1,    9,   16,   20,   24,   36,   43,   49,   53,   58,...
removeBond(idx1, idx2)#

Remove an existing bond between a pair of atoms

Parameters:
  • idx1 (int) – The index of the one atom

  • idx2 (int) – The index of the other atom

renumberResidues(returnMapping=False, start=0, modulo=None)#

Renumbers protein residues incrementally.

It checks for changes in either of the resid, insertion, chain or segid fields and in case of a change it creates a new residue number.

The renumbering is applied in-place and the insertion codes are cleared.

Parameters:
  • returnMapping (bool) – If set to True, the method will also return the mapping between the old and new residues

  • start (int) – The residue number assigned to the first residue. Subsequent residues are numbered incrementally.

  • modulo (int | None) – If given, the new residue numbers are wrapped using modulo arithmetic (resid % modulo).

Returns:

mapping – Only returned if returnMapping is True. A DataFrame mapping the new residue numbers to the old resid, insertion, resname, chain and segid of each residue.

Return type:

pandas.DataFrame

Examples

>>> mapping = mol.renumberResidues(returnMapping=True)
reorderAtoms(order)#

Reorder atoms in Molecule

Changes the order of atoms in the Molecule to the defined order.

Parameters:

order (list | ndarray) – A list containing the new order of atoms

Examples

>>> mol = Molecule()
>>> _ = mol.empty(4)
>>> mol.name[:] = ['N', 'C', 'H', 'S']
>>> neworder = [1, 3, 2, 0]
>>> mol.reorderAtoms(neworder)
>>> print(mol.name)
['C' 'S' 'H' 'N']
reps: Representations#

A list of representations that is used when visualizing the molecule

resid: Annotated[ndarray[tuple[Any, ...], dtype[int64]], 'Shape: (numAtoms,)']#

The residue ID of each atom.

resname: Annotated[ndarray[tuple[Any, ...], dtype[object_]], 'Shape: (numAtoms,)']#

The residue name of each atom.

rotateBy(M, center=(0, 0, 0), sel='all')#

Rotate a selection of atoms by a given rotation matrix around a center

Parameters:
  • M (ndarray) – The rotation matrix

  • center (list | tuple | ndarray) – The rotation center

  • sel (str | ndarray) – An atom selection string, a boolean mask, or an integer index array. Atom selection string for atoms to rotate. See more here

Examples

>>> from moleculekit.util import rotationMatrix
>>> mol = tryp.copy()
>>> mol.rotateBy(rotationMatrix([0, 1, 0], 1.57))
segid: Annotated[ndarray[tuple[Any, ...], dtype[object_]], 'Shape: (numAtoms,)']#

The segment ID of each atom.

sequence(oneletter=True, noseg=False, return_idx=False, sel='all', _logger=True)#

Get the protein/nucleic sequence of the Molecule.

Deprecated since version Use: getSequence() instead. Note that getSequence returns by default a dictionary keyed by chain IDs rather than segment IDs.

Parameters:
  • oneletter (bool) – If True, return the one-letter sequence. Otherwise return three-letter residue names.

  • noseg (bool) – If True, ignore segments and return a single combined sequence.

  • return_idx (bool) – If True, also return the atom indexes corresponding to each residue of the sequence.

  • sel (str | ndarray) – An atom selection string, a boolean mask, or an integer index array. Atom selection string restricting which atoms are used to build the sequence. See more here

Returns:

sequence – A dictionary of sequences keyed by segment ID (or a single sequence if noseg is True).

Return type:

dict

serial: Annotated[ndarray[tuple[Any, ...], dtype[int64]], 'Shape: (numAtoms,)']#

The serial number of each atom.

set(field, value, sel=None)#

Set the values of a Molecule field based on the selection

Parameters:
  • field (str) – The field we want to set. To see a list of all available fields do print(Molecule._atom_and_coord_fields).

  • value (string or integer) – All atoms that match the atom selection will have the field field set to this scalar value (or 3-vector if setting the coordinates)

  • sel (str | ndarray | None) – An atom selection string, a boolean mask, or an integer index array. Atom selection string for atom which to set. See more here

Examples

>>> mol=tryp.copy()
>>> mol.set('segid', 'P', sel='protein')
setDihedral(atom_quad, radians, bonds=None, guessBonds=False)#

Sets the angle of a dihedral.

Parameters:
  • atom_quad (list) – Four atom indexes corresponding to the atoms defining the dihedral

  • radians (float) – The angle in radians to which we want to set the dihedral

  • bonds (ndarray | None) – An array containing all bonds of the molecule. This is needed if multiple modifications are done as the bond guessing can get messed up if atoms come very close after the rotation.

  • guessBonds (bool) – Set to True if you want to guess bonds based on atom distances if they are not defined

Examples

>>> mol.setDihedral([0, 5, 8, 12], 0.16)
>>> # If we perform multiple modifications, calculate bonds first and pass them as argument to be safe
>>> bonds = mol._getBonds()
>>> mol.setDihedral([0, 5, 8, 12], 0.16, bonds=bonds)
>>> mol.setDihedral([18, 20, 24, 30], -1.8, bonds=bonds)
step: Annotated[ndarray[tuple[Any, ...], dtype[uint64]], 'Shape: (numFrames)']#

The step for each frame of the simulation

templateResidueFromMolecule(sel, refmol, addHs=False, onlyOnAtoms=None, guessBonds=False, _logger=True)#

Assign bonds, bond orders, formal charges and (optionally) hydrogens to a residue from a reference Molecule template.

Like templateResidueFromSmiles(), but the template is a reference Molecule (e.g. loaded from a CIF) that already carries bonds, bond orders and formal charges. When the reference’s heavy-atom names are unique and equal to the residue’s, the atoms are mapped by NAME and the reference’s bond orders and formal charges are transferred verbatim (ideal for CIF references: unambiguous under molecular symmetry). When the names do not match (for example a reference read from an SDF file, whose atom names are only element symbols), the reference is converted to a SMILES and matched by element and connectivity instead; for a symmetric residue this can place a charge or double bond on an equivalent atom differently while giving the same molecule. Either way the reference is used only as a template and is never appended, and the molecule is mutated in place. The reference must describe the same residue: it may carry extra terminal atoms (such as a free amino acid’s OXT or a covalent leaving group), which are stripped, but a reference missing heavy atoms of the residue raises.

Parameters:
  • sel (str | ndarray) – An atom selection string, a boolean mask, or an integer index array of the residue(s) to template. May span multiple copies.

  • refmol (Molecule) – The reference template. Its bonds, bond orders and formal charges must already be correct. When its heavy-atom names are unique and match the residue’s they are used directly; otherwise it is matched by SMILES, so unnamed references (e.g. from SDF) are supported.

  • addHs (bool) – If True, add hydrogens after bond orders are transferred.

  • onlyOnAtoms (str | ndarray | None) – Restrict which heavy atoms get hydrogens (only used with addHs).

  • guessBonds (bool) – If True, distance-guess the residue’s bonds before templating.

Examples

>>> mol = Molecule("complex.pdb")
>>> mol.templateResidueFromMolecule("resname LIG", Molecule("LIG.cif"), addHs=True, guessBonds=True)
templateResidueFromSmiles(sel, smiles, sanitizeSmiles=True, addHs=False, onlyOnAtoms=None, guessBonds=False, _logger=True)#

Assign bonds, bond orders, formal charges and (optionally) hydrogens to a residue from a SMILES template.

Uses RDKit’s Maximum Common Substructure (MCS) matching between the residue’s current bond graph and the SMILES template to transfer bond orders and formal charges. The molecule is mutated in place: the matched residue’s atoms are replaced by the templated copy.

Multiple residues can be templated in one call when sel spans several copies (e.g. "resname NAG" for several NAG residues, or a boolean mask covering multiple chain residues). Each residue is templated individually with the same SMILES, in residue order.

Cross-residue covalent bonds (peptide N-C, nucleic acid phosphodiester P-O3’, and any bond already present in mol.bonds that crosses the residue boundary) are detected and the boundary atoms’ H counts are reduced accordingly so addHs=True does not over-protonate them. If mol.bonds is empty for the residue, pass guessBonds=True to populate it via distance-based guessing.

If the SMILES template has heavy atoms that don’t map onto the residue (typically a leaving group displaced by a covalent link, or the terminal -OH / -OXT on a mid-chain amino acid SMILES), the function attempts to strip those terminal atoms automatically and retry the MCS match. If the mismatch can’t be resolved this way, a RuntimeError is raised.

Parameters:
  • sel (str | ndarray) – An atom selection string, a boolean mask, or an integer index array. VMD-style atom selection or boolean mask of the residue(s) to template. May span multiple residues with the same chemistry.

  • smiles (str) – SMILES string of the template residue. RCSB-style ligand SMILES (i.e. fully protonated, with explicit formal charges and the full set of heavy atoms) work best.

  • sanitizeSmiles (bool) – If True, the SMILES is sanitized by RDKit before matching.

  • addHs (bool) – If True, hydrogens are added to the residue using RDKit’s AddHs after bond orders are transferred, respecting the boundary-bond H-count corrections described above.

  • onlyOnAtoms (str | ndarray | None) – An atom selection string, a boolean mask, or an integer index array. VMD-style selection within the residue restricting which heavy atoms get hydrogens added. Only used when addHs=True.

  • guessBonds (bool) – If True, run distance-based bond guessing on the residue before templating. Use this when mol.bonds is empty for the selection (e.g. PDB inputs without CONECT records).

Raises:

RuntimeError – If the selection is empty, spans multiple residues with gaps in atom indexes, has no bonds, or the SMILES contains heavy atoms that cannot be matched (even after auto-stripping recognized terminal atoms).

Examples

>>> mol = Molecule("3ptb")
>>> mol.templateResidueFromSmiles("resname BEN", "[NH2+]=C(N)c1ccccc1", addHs=True)
>>> mol.templateResidueFromSmiles("resname GLY and resid 18", "C(C(=O))N", addHs=True)

Template every copy of a sugar at once (each residue templated individually with the same SMILES):

>>> mol.templateResidueFromSmiles(
...     "resname NAG",
...     "CC(=O)NC1C(O)C(O)C(CO)OC1O",
...     addHs=True,
... )
time: Annotated[ndarray[tuple[Any, ...], dtype[float64]], 'Shape: (numFrames)']#

The time for each frame of the simulation

toDict(fields=None)#

Returns a dictionary representation of the molecule

Parameters:

fields (list | None) – The fields to include in the representation. By default it will include only topology fields.

Returns:

result – A dictionary mapping each requested field name to its value, with numpy arrays converted to lists.

Return type:

dict

toGraph(fields=None, distances=False)#

Converts the Molecule to a networkx graph.

Each node corresponds to an atom and edges correspond to bonds.

Parameters:
  • fields (str | list | None) – The atom fields to attach as attributes to each node. If None, all per-atom fields are used.

  • distances (bool) – If set to True, each edge will additionally carry a ‘distance’ attribute with the distance between the two bonded atoms in the currently active frame.

Returns:

graph – A graph whose nodes are atom indexes (carrying the selected fields as attributes) and whose edges are the bonds (carrying a ‘type’ attribute and, optionally, a ‘distance’ attribute).

Return type:

networkx.Graph

toOpenFFMolecule(sanitize=False, kekulize=False, assignStereo=True)#

Convert the Molecule to an OpenFF Molecule.

The conversion goes through an RDKit molecule. Partial charges are taken from the charge field and the per-atom residue identity (resname, resid, chain, insertion) is propagated into the OpenFF Molecule metadata so that its residue/chain hierarchy schemes can reproduce it.

Parameters:
  • sanitize (bool) – Whether to sanitize the intermediate RDKit molecule.

  • kekulize (bool) – Whether to kekulize the intermediate RDKit molecule.

  • assignStereo (bool) – Whether to assign stereochemistry on the intermediate RDKit molecule.

Returns:

offmol – The OpenFF Molecule representation of this Molecule.

Return type:

openff.toolkit.topology.Molecule

toRDKitMol(sanitize=False, kekulize=False, assignStereo=True, guessBonds=False, _logger=True)#

Converts the Molecule to an RDKit molecule

Parameters:
  • sanitize (bool) – If True the molecule will be sanitized

  • kekulize (bool) – If True the molecule will be kekulized

  • assignStereo (bool) – If True the molecule will have stereochemistry assigned from its 3D coordinates

  • guessBonds (bool) – If True the molecule will have bonds guessed

translateBy(vector, sel=None)#

Move a selection of atoms by a given vector

Parameters:
  • vector (list) – 3D coordinates to add to the Molecule coordinates

  • sel (str | ndarray | None) – An atom selection string, a boolean mask, or an integer index array. Atom selection string of atoms which we want to move. See more here

Examples

>>> mol=tryp.copy()
>>> mol.translateBy([3, 45 , -8])
view(sel=None, style=None, color=None, guessBonds=True, viewer=None, hold=False, name=None, viewerhandle=None, gui=False)#

Visualizes the molecule in a molecular viewer

Parameters:
  • sel (str | ndarray | None) – An atom selection string, a boolean mask, or an integer index array. Atom selection string for the representation. See more here

  • style (str | None) – Representation style. See more here.

  • color (str | int | None) – Coloring mode (str) or ColorID (int). See more here.

  • guessBonds (bool) – Allow the viewer to guess bonds for the molecule

  • viewer (str | None) – Choose viewer backend. Resolution order: explicit viewer= argument, then the MOLECULEKIT_VIEWER environment variable, then moleculekit.config["viewer"], then auto-detection of vmd/pymol in PATH, then molstar as the fallback.

  • hold (bool) – If set to True, it will not visualize the molecule but instead collect representations until set back to False.

  • name (str | None) – A name to give to the molecule in the viewer

  • viewerhandle (VMD object, optional) – A specific viewer in which to visualize the molecule. If None it will use the current default viewer.

  • gui (bool) – If set to True, show the graphical user interface of the viewer (only used by the webgl/ngl backend).

Returns:

The viewer handle for the webgl/ngl and molstar backends. For other backends and when hold is True nothing is returned.

Return type:

viewer

viewname: str#

The name used for the molecule in the viewer

virtualsite: Annotated[ndarray[tuple[Any, ...], dtype[bool]], 'Shape: (numAtoms,)']#

Whether the atom is a virtual site.

wrap(wrapsel='all', fileBonds=True, guessBonds=False, wrapcenter=None, unitcell='rectangular')#

Wraps the coordinates of the molecule into the simulation box

It assumes that all bonded groups are sequential in Molecule. I.e. you don’t have a molecule B in between the atoms of molecule A. It also requires correct bonding (ideally read from a topology file).

Parameters:
  • wrapsel (str | ndarray) – An atom selection string, a boolean mask, or an integer index array. Atom selection string of atoms on which to center the wrapping box. See more here

  • fileBonds (bool) – Whether to use the bonds read from the file or to guess them

  • guessBonds (bool) – Whether to guess the bonds. If fileBonds is True these will get appended

  • wrapcenter (array_like, optional) – The center around which to wrap. If not provided, it will be calculated from the atoms in wrapsel. Normally you want to use the wrapsel option and not the wrapcenter as the coordinates of the selection can change during a simulation and wrapsel will keep that selection in the center for all frames.

  • unitcell (str) – This option can be used for choosing between different unit cell representations of triclinic boxes. It doesn’t have any effect on rectangular boxes. The wrapping of a triclinic cell can be “rectangular”, “triclinic” or “compact”. Rectangular wrapping is the default and it wraps the box into a parallelepiped. Triclinic wrapping wraps the box into a triclinic box. Compact wrapping wraps the box into a shape that has the minimum volume. This can be useful for visualizing e.g. truncated octahedra or rhombic dodecahedra.

Examples

>>> mol=tryp.copy()
>>> mol.wrap()
>>> mol.wrap('protein')
write(filename, sel=None, type=None, **kwargs)#

Writes the topology and coordinates of the Molecule in any of the supported formats.

Parameters:
  • filename (str) – The filename of the file we want to write to disk

  • sel (str | ndarray | None) – An atom selection string, a boolean mask, or an integer index array. Atom selection string of the atoms we want to write. If None, it will write all atoms. See more here

  • type (str | None) – The filetype we want to write. By default, detected from the file extension

property x#

Get the x coordinates at the current frame

property y#

Get the y coordinates at the current frame

property z#

Get the z coordinates at the current frame

exception moleculekit.molecule.TopologyInconsistencyError(value)#

Bases: Exception

Raised when the topology of a Molecule is inconsistent or invalid.

class moleculekit.molecule.UniqueAtomID(**kwargs)#

Bases: object

static fromMolecule(mol, sel=None, idx=None)#

Create a UniqueAtomID from a single atom of a Molecule.

Exactly one of sel or idx must be given, and it must resolve to exactly one atom.

Parameters:
  • mol (Molecule) – The Molecule from which to read the atom identity.

  • sel (str | ndarray | None) – An atom selection string, a boolean mask, or an integer index array. An atom selection string that must match exactly one atom.

  • idx (int | None) – The index of the atom.

Returns:

uqid – A unique identifier for the selected atom.

Return type:

UniqueAtomID

selectAtom(mol, indexes=True, ignore=None)#

Locate the atom matching this identifier in a Molecule.

Parameters:
  • mol (Molecule) – The Molecule in which to locate the atom.

  • indexes (bool) – If True, return the integer index of the matching atom. If False, return a boolean mask.

  • ignore (str | list | None) – One or more identifier fields to ignore when matching.

Returns:

atom – The index of the matching atom if indexes is True, otherwise a boolean mask flagging it.

Return type:

int or numpy.ndarray

Raises:

RuntimeError – If the atom is no longer unique or no longer present in the Molecule.

class moleculekit.molecule.UniqueResidueID(**kwargs)#

Bases: object

static fromMolecule(mol, sel=None, idx=None)#
Return type:

UniqueResidueID

selectAtoms(mol, indexes=True, ignore=None)#

Locate the atoms of the residue matching this identifier in a Molecule.

Parameters:
  • mol (Molecule) – The Molecule in which to locate the residue.

  • indexes (bool) – If True, return the integer indexes of the matching atoms. If False, return a boolean mask.

  • ignore (str | list | None) – One or more identifier fields to ignore when matching.

Returns:

atoms – The indexes of the matching atoms if indexes is True, otherwise a boolean mask flagging them.

Return type:

ndarray

Raises:

RuntimeError – If no atoms of the residue are present in the Molecule.

moleculekit.molecule.calculateUniqueBonds(bonds, bondtype)#

Given bonds and bondtypes calculates unique bonds dropping any duplicates

Parameters:
  • bonds (ndarray) – The bonds of a molecule

  • bondtype (ndarray) – The bond type of each bond in the bonds array

Returns:

  • uqbonds (numpy.ndarray) – The unique bonds of the molecule

  • uqbondtype (numpy.ndarray) – The corresponding bond types for uqbonds

Examples

>>> from moleculekit.molecule import Molecule
>>> mol = Molecule('3PTB')
>>> mol.bonds, mol.bondtype = calculateUniqueBonds(mol.bonds, mol.bondtype)  # Overwrite the bonds and bondtypes with the unique ones
moleculekit.molecule.getBondedGroups(mol, bonds=None)#

Calculates all bonded groups in a Molecule

Parameters:
  • mol (Molecule) – A Molecule object

  • bonds (ndarray | None) – Optionally pass a different array of bonds. If None it will take the bonds from mol.bonds.

Returns:

  • groups (numpy.ndarray) – Groups is an array which contains the starting index of each group.

  • group (numpy.ndarray) – An array with the group index of each atom

Examples

>>> mol = Molecule("structure.prmtop")
>>> mol.read("output.xtc")
>>> groups, _ = getBondedGroups(mol)
>>> for i in range(len(groups)-1):
...     print(f"Group {i} starts at index {groups[i]} and ends at index {groups[i+1]-1}")
moleculekit.molecule.mol_equal(mol1, mol2, checkFields=('record', 'serial', 'name', 'altloc', 'resname', 'chain', 'resid', 'insertion', 'occupancy', 'beta', 'segid', 'element', 'charge', 'masses', 'atomtype', 'formalcharge', 'virtualsite', 'coords'), exceptFields=None, fieldPrecision=None, dtypes=False, uqBonds=False, _logger=True)#

Compare two Molecules for equality.

Parameters:
  • mol1 (Molecule) – The first molecule to compare

  • mol2 (Molecule) – The second molecule to compare to the first

  • checkFields (list) – A list of fields to compare. By default compares all atom information and coordinates in the molecule

  • exceptFields (list | None) – A list of fields to not compare.

  • fieldPrecision (dict | None) – A dictionary of field, precision key-value pairs which defines the numerical precision of the value comparisons of two arrays

  • dtypes (bool) – Set to True to also compare datatypes of the fields

  • uqBonds (bool) – Set to True to compare unique bonds instead of all bonds

Returns:

equal – Returns True if the molecules are equal or False if they are not.

Return type:

bool

Examples

>>> mol_equal(mol1, mol2, checkFields=['resname', 'resid', 'segid'])
>>> mol_equal(mol1, mol2, exceptFields=['record', 'name'])
>>> mol_equal(mol1, mol2, fieldPrecision={'coords': 1e-5})