moleculekit.molecule module¶

class moleculekit.molecule.Molecule(filename=None, name=None, **kwargs)¶

Bases: object

Class to manipulate molecular structures.

Molecule contains all the fields of a PDB and it is independent of any force field. It can contain multiple conformations and trajectories, however all operations are done on the current frame. The following PDB fields are accessible as attributes (record, serial, name, altloc, resname, chain, resid, insertion, coords, occupancy, beta, segid, element, charge). The coordinates are accessible via the coords attribute ([number of atoms x 3 x number of frames] where [x,y,z] are the second dimension.

Parameters:

filename (str or list of str) – Optionally load a PDB file from the specified file. If there’s no file and the value is four characters long assume it is a PDB accession code and try to download from the RCSB web server.
name (str) – Give a name to the Molecule that will be used for visualization
kwargs – Accepts any further arguments that should be passed to the Molecule.read method.

Examples

>>> mol = Molecule( './test/data/dhfr/dhfr.pdb' )  
>>> mol = Molecule( '3PTB', name='Trypsin' )
>>> print(mol)                                     
Molecule with 1701 atoms and 1 frames
Atom field - altloc shape: (1701,)
Atom field - atomtype shape: (1701,)
...

Methods

Attributes

numAtoms¶: int – Number of atoms in the Molecule

numFrames¶: int – Number of conformers / simulation frames in the Molecule

numResidues¶: int – Number of residues in the Molecule

record¶: np.ndarray – The record field of a PDB file if the topology was read from a PDB.

serial¶: np.ndarray – The serial number of each atom.

name¶: np.ndarray – The name of each atom.

altloc¶: np.ndarray – The alternative location flag of the atoms if read from a PDB.

resname¶: np.ndarray – The residue name of each atom.

chain¶: np.ndarray – The chain name of each atom.

resid¶: np.ndarray – The residue ID of each atom.

insertion¶: np.ndarray – The insertion flag of the atoms if read from a PDB.

occupancy¶: np.ndarray – The occupancy value of each atom if read from a PDB.

beta¶: np.ndarray – The beta factor value of each atom if read from a PDB.

segid¶: np.ndarray – The segment ID of each atom.

element¶: np.ndarray – The element of each atom.

charge¶: np.ndarray – The charge of each atom.

masses¶: np.ndarray – The mass of each atom.

atomtype¶: np.ndarray – The atom type of each atom.

coords¶: np.ndarray – A float32 array with shape (natoms, 3, nframes) containing the coordinates of the Molecule.

box¶: np.ndarray – A float32 array with shape (3, nframes) containing the periodic box dimensions of an MD trajectory.

boxangles¶: np.ndarray – The angles of the box. If none are set they are assumed to be 90 degrees.

bonds¶: np.ndarray – Atom pairs corresponding to bond terms.

bondtype¶: np.ndarray – The type of each bond in Molecule.bonds if available.

angles¶: np.ndarray – Atom triplets corresponding to angle terms.

dihedrals¶: np.ndarray – Atom quadruplets corresponding to dihedral terms.

impropers¶: np.ndarray – Atom quadruplets corresponding to improper dihedral terms.

crystalinfo¶: dict – A dictionary containing crystallographic information. It has fields [‘sGroup’, ‘numcopies’, ‘rotations’, ‘translations’]

frame¶: int – The current frame. atomselection and get commands will be calculated on this frame.

fileloc¶: list – The location of the files used to read this Molecule

time¶: list – The time for each frame of the simulation

fstep¶: list – The step for each frame of the simulation

reps¶: Representations object – A list of representations that is used when visualizing the molecule

viewname¶: str – The name used for the molecule in the viewer

align(sel, refmol=None, refsel=None, frames=None, matchingframes=False)¶

Align conformations.

Align a given set of frames of this molecule to either the current active frame of this molecule (mol.frame) or the current frame of a different reference molecule. To align to any frame other than the current active one modify the refmol.frame property before calling this method.

Parameters:

sel (str) – Atom selection string for aligning. See more here
refmol (Molecule, optional) – Optionally pass a reference Molecule on which to align. If None is given, it will align on the first frame of the same Molecule
refsel (str, optional) – Atom selection for the refmol if one is given. Default: same as sel. See more here
frames (list or range) – A list of frames which to align. By default it will align all frames of the Molecule
matchingframes (bool) – If set to True it will align the selected frames of this molecule to the corresponding frames of the refmol. This requires both molecules to have the same number of frames.

Examples

>>> mol=tryp.copy()
>>> mol.align('protein')
>>> mol.align('name CA', refmol=Molecule('3PTB'))

alignBySequence(ref, molseg=None, refseg=None, nalignfragment=1, returnAlignments=False, maxalignments=1)¶

Aligns the Molecule to a reference Molecule by their longest sequence alignment

Parameters:	ref (`Molecule` object) – The reference Molecule to which we want to align molseg (str) – The segment of this Molecule we want to align refseg (str) – The segment of ref we want to align to nalignfragments (int) – The number of fragments used for the alignment. returnAlignments (bool) – Return all alignments as a list of Molecules maxalignments (int) – The maximum number of alignments we want to produce
Returns:	mols – If returnAlignments is True it returns a list of Molecules each containing a different alignment. Otherwise it modifies the current Molecule with the best single alignment.
Return type:	list

append(mol, collisions=False, coldist=1.3)¶

Append a molecule at the end of the current molecule

Parameters:	mol (`Molecule`) – Target Molecule which to append to the end of the current Molecule collisions (bool) – If set to True it will remove residues of mol which collide with atoms of this Molecule object. coldist (float) – Collision distance in Angstrom between atoms of the two molecules. Anything closer will be considered a collision.

Example

>>> mol=tryp.copy()
>>> mol.filter("not resname BEN")
>>> lig=tryp.copy()
>>> lig.filter("resname BEN")
>>> mol.append(lig)

appendFrames(mol)¶

Appends the frames of another Molecule object to this object.

Parameters:	mol (`Molecule`) – A Molecule object.

atomselect(sel, indexes=False, strict=False, fileBonds=True, guessBonds=True)¶

Get a boolean mask or the indexes of a set of selected atoms

Parameters:	sel (str) – Atom selection string. See more here indexes (bool) – If True returns the indexes instead of a bitmap strict (bool) – If True it will raise an error if no atoms were selected. fileBonds (bool) – If True will use bonds read from files. guessBonds (bool) – If True will use guessed bonds.
Returns:	asel – Either a boolean mask of selected atoms or their indexes
Return type:	np.ndarray

Examples

>>> mol=tryp.copy()
>>> mol.atomselect('resname MOL')
array([False, False, False, ..., False, False, False], dtype=bool)

center(loc=(0, 0, 0), sel='all')¶

Moves the geometric center of the Molecule to a given location

Parameters:	loc (list, optional) – The location to which to move the geometric center sel (str) – Atom selection string of the atoms whose geometric center we want to center on the loc position. See more here

Examples

>>> mol=tryp.copy()
>>> mol.center()
>>> mol.center([10, 10, 10], 'name CA')

copy()¶

Create a copy of the Molecule object

Returns:	newmol – A copy of the object
Return type:	`Molecule`

deleteBonds(sel, inter=True)¶

Deletes all bonds that contain atoms in sel or between atoms in sel.

Parameters:	sel (str) – Atom selection string of atoms whose bonds will be deleted. See more here inter (bool) – When True it will delete also bonds between atoms in sel with bonds to atoms outside of sel. When False it will only delete bonds between atoms in sel.

dropFrames(keep='all', drop=None)¶

Removes trajectory frames from the Molecule

Parameters:	keep (int or list of ints) – Index of frame, or list of frame indexes which we want to keep (and drop all others). drop (int or list of ints) – Index of frame, or list of frame indexes which we want to drop (and keep all others).

Examples

>>> mol = Molecule('1sb0')
>>> mol.dropFrames(keep=[1,2])
>>> mol.numFrames == 2
>>> mol.dropFrames(drop=[0])
>>> mol.numFrames == 1

empty(numAtoms)¶

Creates an empty molecule of numAtoms atoms.

Parameters:	numAtoms (int) – Number of atoms to create in the molecule.

Example

>>> newmol = Molecule().empty(100)

filter(sel, _logger=True)¶

Removes all atoms not included in the selection

Parameters:	sel (str) – Atom selection string. See more here

Examples

>>> mol=tryp.copy()
>>> mol.filter('protein')

frame: The currently active frame of the Molecule on which methods will be applied

fstep: The frame-step of the trajectory

get(field, sel=None)¶

Retrieve a specific PDB field based on the selection

Parameters:	field (str) – The field we want to get. To see a list of all available fields do print(Molecule._atom_and_coord_fields). sel (str) – Atom selection string for which atoms we want to get the field from. Default all. See more here
Returns:	vals – Array of values of field for all atoms in the selection.
Return type:	np.ndarray

Examples

>>> mol=tryp.copy()
>>> mol.get('resname')
array(['ILE', 'ILE', 'ILE', ..., 'HOH', 'HOH', 'HOH'], dtype=object)
>>> mol.get('resname', sel='resid 158')
array(['LEU', 'LEU', 'LEU', 'LEU', 'LEU', 'LEU', 'LEU', 'LEU'], dtype=object)

getDihedral(atom_quad)¶

Get the value of a dihedral angle.

Parameters:	atom_quad (list) – Four atom indexes corresponding to the atoms defining the dihedral
Returns:	angle – The angle in radians
Return type:	float

Examples

>>> mol.getDihedral([0, 5, 8, 12])

insert(mol, index, collisions=0, coldist=1.3)¶

Insert the atoms of one molecule into another at a specific index.

Parameters:

mol (Molecule) – Molecule to be inserted
index (integer) – The atom index at which the passed molecule will be inserted
collisions (bool) – If set to True it will remove residues of mol which collide with atoms of this Molecule object.
coldist (float) – Collision distance in Angstrom between atoms of the two molecules. Anything closer will be considered a collision.

Example

>>> mol=tryp.copy()
>>> mol.numAtoms
1701
>>> mol.insert(tryp, 0)
>>> mol.numAtoms
3402

moveBy(vector, sel=None)¶

Move a selection of atoms by a given vector

Parameters:	vector (list) – 3D coordinates to add to the Molecule coordinates sel (str) – Atom selection string of atoms which we want to move. See more here

Examples

>>> mol=tryp.copy()
>>> mol.moveBy([3, 45 , -8])

mutateResidue(sel, newres)¶

Mutates a residue by deleting its sidechain and renaming it

Parameters:	sel (str) – Atom selection string for the residue we want to mutate. The selection needs to include all atoms of the residue. See more here newres (str) – The name of the new residue

Examples

>>> mol=tryp.copy()
>>> mol.mutateResidue('resid 158', 'ARG')

numAtoms: Number of atoms in the molecule

numFrames: Number of coordinate frames in the molecule

numResidues: The number of residues in the Molecule

read(filename, type=None, skip=None, frames=None, append=False, overwrite='all', keepaltloc='A', guess=None, guessNE=None, _logger=True, **kwargs)¶

Read topology, coordinates and trajectory files in multiple formats.

Detects from the extension the file type and loads it into Molecule

Parameters:

filename (str) – Name of the file we want to read
type (str, optional) – File type of the file. If None, it’s automatically determined by the extension
skip (int, optional) – If the file is a trajectory, skip every skip frames
frames (list, optional) – If the file is a trajectory, read only the given frames
append (bool, optional) – If the file is a trajectory or coor file, append the coordinates to the previous coordinates. Note append is slow.
overwrite (str, list of str) – A list of the existing fields in Molecule that we wish to overwrite when reading this file. Set to None if you don’t want to overwrite any existing fields.
keepaltloc (str) – Set to any string to only keep that specific altloc. Set to ‘all’ if you want to keep all alternative atom positions.
guess (list of str) – Properties of the molecule to guess. Can be any combination of (‘bonds’, ‘angles’, ‘dihedrals’)
guessNE (list of str) – Properties of the molecule to guess if it’s Non-Existent. Can be any combination of (‘bonds’, ‘angles’, ‘dihedrals’)

remove(selection, _logger=True)¶

Remove atoms from the Molecule

Parameters:	selection (str) – Atom selection string of the atoms we want to remove. See more here
Returns:	removed – The list of atoms removed
Return type:	np.array

Example

>>> mol=tryp.copy()
>>> mol.remove('name CA')               
array([   1,    9,   16,   20,   24,   36,   43,   49,   53,   58,...

renumberResidues(returnMapping=False)¶

Renumbers protein residues incrementally.

It checks for changes in either of the resid, insertion, chain or segid fields and in case of a change it creates a new residue number.

Parameters:	returnMapping (bool) – If set to True, the method will also return the mapping between the old and new residues

Examples

>>> mapping = mol.renumberResidues(returnMapping=True)

reorderAtoms(order)¶

Reorder atoms in Molecule

Changes the order of atoms in the Molecule to the defined order.

Parameters:	order (list) – A list containing the new order of atoms

Examples

>>> mol = Molecule()
>>> mol.empty(4)
>>> mol.name[:] = ['N', 'C', 'H', 'S']
>>> neworder = [1, 3, 2, 0]
>>> mol.reorderAtoms(neworder)
>>> print(mol.name)
array(['C', 'S', 'H', 'N'], dtype=object)

rotateBy(M, center=(0, 0, 0), sel='all')¶

Rotate a selection of atoms by a given rotation matrix around a center

Parameters:	M (np.ndarray) – The rotation matrix center (list) – The rotation center sel (str) – Atom selection string for atoms to rotate. See more here

Examples

>>> mol = tryp.copy()
>>> mol.rotateBy(rotationMatrix([0, 1, 0], 1.57))

sequence(oneletter=True, noseg=False)¶

Return the aminoacid sequence of the Molecule.

Parameters:	oneletter (bool) – Whether to return one-letter or three-letter AA codes. There should be only one atom per residue. noseg (bool) – Ignore segments and return the whole sequence as single string.
Returns:	sequence – The primary sequence as a dictionary segid - string (if oneletter is True) or segid - list of strings (otherwise).
Return type:	str

Examples

>>> mol=tryp.copy()
>>> mol.sequence()
{'0': 'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'}
>>> sh2 = Molecule("1LKK")
>>> pYseq = sh2.sequence(oneletter=False)
>>> pYseq['1']
['PTR', 'GLU', 'GLU', 'ILE']
>>> pYseq = sh2.sequence(oneletter=True)
>>> pYseq['1']
'XEEI'

set(field, value, sel=None)¶

Set the values of a Molecule field based on the selection

Parameters:	field (str) – The field we want to set. To see a list of all available fields do print(Molecule._atom_and_coord_fields). value (string or integer) – All atoms that match the atom selection will have the field field set to this scalar value (or 3-vector if setting the coordinates) sel (str) – Atom selection string for atom which to set. See more here

Examples

>>> mol=tryp.copy()
>>> mol.set('segid', 'P', sel='protein')

setDihedral(atom_quad, radians, bonds=None)¶

Sets the angle of a dihedral.

Parameters:	atom_quad (list) – Four atom indexes corresponding to the atoms defining the dihedral radians (float) – The angle in radians to which we want to set the dihedral bonds (np.ndarray) – An array containing all bonds of the molecule. This is needed if multiple modifications are done as the bond guessing can get messed up if atoms come very close after the rotation.

Examples

>>> mol.setDihedral([0, 5, 8, 12], 0.16)
>>> # If we perform multiple modifications, calculate bonds first and pass them as argument to be safe
>>> bonds = mol._getBonds()
>>> mol.setDihedral([0, 5, 8, 12], 0.16, bonds=bonds)
>>> mol.setDihedral([18, 20, 24, 30], -1.8, bonds=bonds)

view(sel=None, style=None, color=None, guessBonds=True, viewer=None, hold=False, name=None, viewerhandle=None, gui=False)¶

Visualizes the molecule in a molecular viewer

Parameters:

sel (str) – Atom selection string for the representation. See more here
style (str) – Representation style. See more here.
color (str or int) – Coloring mode (str) or ColorID (int). See more here.
guessBonds (bool) – Allow VMD to guess bonds for the molecule
viewer (str ('vmd', 'webgl')) – Choose viewer backend. Default is taken from either moleculekit.config or if it doesn’t exist from moleculekit.config
hold (bool) – If set to True, it will not visualize the molecule but instead collect representations until set back to False.
name (str, optional) – A name to give to the molecule in VMD
viewerhandle (VMD object, optional) – A specific viewer in which to visualize the molecule. If None it will use the current default viewer.

viewCrystalPacking(viewerhandle=None)¶: If the Molecule was read from a crystallographic PDB structure it shows the crystal packing of the molecule.

wrap(wrapsel=None, fileBonds=True, guessBonds=True)¶

Wraps the coordinates of the molecule into the simulation box

Parameters:	wrapsel (str) – Atom selection string of atoms on which to center the wrapping box. See more here

Examples

>>> mol=tryp.copy()
>>> mol.wrap()
>>> mol.wrap('protein')

write(filename, sel=None, type=None, **kwargs)¶

Writes the topology and coordinates of the Molecule in any of the supported formats.

Parameters:	filename (str) – The filename of the file we want to write to disk sel (str, optional) – Atom selection string of the atoms we want to write. If None, it will write all atoms. See more here type (str, optional) – The filetype we want to write. By default, detected from the file extension

x¶: Get the x coordinates at the current frame

y¶: Get the y coordinates at the current frame

z¶: Get the z coordinates at the current frame

class moleculekit.molecule.Representations(mol)¶

Bases: object

Class that stores representations for Molecule.

Examples

>>> from moleculekit.molecule import Molecule
>>> mol = tryp.copy()
>>> mol.reps.add('protein', 'NewCartoon')
>>> print(mol.reps)                     
rep 0: sel='protein', style='NewCartoon', color='Name'
>>> mol.view() 
>>> mol.reps.remove() 

add(sel=None, style=None, color=None)¶

Adds a new representation for Molecule.

Parameters:	sel (str) – Atom selection string for the representation. See more here style (str) – Representation style. See more here. color (str or int) – Coloring mode (str) or ColorID (int). See more here.

append(reps)¶

list()¶: Lists all representations. Equivalent to using print.

remove(index=None)¶

Removed one or all representations.

Parameters:	index (int) – The index of the representation to delete. If none is given it deletes all.

exception moleculekit.molecule.TopologyInconsistencyError(value)¶

Bases: Exception

args¶

with_traceback()¶: Exception.with_traceback(tb) – set self.__traceback__ to tb and return self.

class moleculekit.molecule.UniqueAtomID(**kwargs)¶

Bases: object

static fromMolecule(sel=None, idx=None)¶

selectAtom(mol, indexes=True, ignore=None)¶

class moleculekit.molecule.UniqueResidueID(**kwargs)¶

Bases: object

static fromMolecule(sel=None, idx=None)¶

selectAtoms(mol, indexes=True, ignore=None)¶

moleculekit.molecule.mol_equal(mol1, mol2, checkFields=('record', 'serial', 'name', 'altloc', 'resname', 'chain', 'resid', 'insertion', 'occupancy', 'beta', 'segid', 'element', 'charge', 'masses', 'atomtype', 'coords'), exceptFields=None, _logger=True)¶